Mar 09 20:00:49 localhost kernel: Linux version 5.14.0-687.el9.x86_64 (mockbuild@x86-05.stream.rdu2.redhat.com) (gcc (GCC) 11.5.0 20240719 (Red Hat 11.5.0-14), GNU ld version 2.35.2-72.el9) #1 SMP PREEMPT_DYNAMIC Mon Feb 23 11:11:46 UTC 2026 Mar 09 20:00:49 localhost kernel: The list of certified hardware and cloud instances for Red Hat Enterprise Linux 9 can be viewed at the Red Hat Ecosystem Catalog, https://catalog.redhat.com. Mar 09 20:00:49 localhost kernel: Command line: BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-687.el9.x86_64 root=UUID=d70e3b08-39eb-4644-ba12-579a10c34a4e ro console=ttyS0,115200n8 no_timer_check net.ifnames=0 crashkernel=1G-2G:192M,2G-64G:256M,64G-:512M Mar 09 20:00:49 localhost kernel: BIOS-provided physical RAM map: Mar 09 20:00:49 localhost kernel: BIOS-e820: [mem 0x0000000000000000-0x000000000009fbff] usable Mar 09 20:00:49 localhost kernel: BIOS-e820: [mem 0x000000000009fc00-0x000000000009ffff] reserved Mar 09 20:00:49 localhost kernel: BIOS-e820: [mem 0x00000000000f0000-0x00000000000fffff] reserved Mar 09 20:00:49 localhost kernel: BIOS-e820: [mem 0x0000000000100000-0x00000000bffdafff] usable Mar 09 20:00:49 localhost kernel: BIOS-e820: [mem 0x00000000bffdb000-0x00000000bfffffff] reserved Mar 09 20:00:49 localhost kernel: BIOS-e820: [mem 0x00000000feffc000-0x00000000feffffff] reserved Mar 09 20:00:49 localhost kernel: BIOS-e820: [mem 0x00000000fffc0000-0x00000000ffffffff] reserved Mar 09 20:00:49 localhost kernel: BIOS-e820: [mem 0x0000000100000000-0x000000023fffffff] usable Mar 09 20:00:49 localhost kernel: NX (Execute Disable) protection: active Mar 09 20:00:49 localhost kernel: APIC: Static calls initialized Mar 09 20:00:49 localhost kernel: SMBIOS 2.8 present. Mar 09 20:00:49 localhost kernel: DMI: OpenStack Foundation OpenStack Nova, BIOS 1.15.0-1 04/01/2014 Mar 09 20:00:49 localhost kernel: Hypervisor detected: KVM Mar 09 20:00:49 localhost kernel: kvm-clock: Using msrs 4b564d01 and 4b564d00 Mar 09 20:00:49 localhost kernel: kvm-clock: using sched offset of 8037112149 cycles Mar 09 20:00:49 localhost kernel: clocksource: kvm-clock: mask: 0xffffffffffffffff max_cycles: 0x1cd42e4dffb, max_idle_ns: 881590591483 ns Mar 09 20:00:49 localhost kernel: tsc: Detected 2799.998 MHz processor Mar 09 20:00:49 localhost kernel: e820: update [mem 0x00000000-0x00000fff] usable ==> reserved Mar 09 20:00:49 localhost kernel: e820: remove [mem 0x000a0000-0x000fffff] usable Mar 09 20:00:49 localhost kernel: last_pfn = 0x240000 max_arch_pfn = 0x400000000 Mar 09 20:00:49 localhost kernel: MTRR map: 4 entries (3 fixed + 1 variable; max 19), built from 8 variable MTRRs Mar 09 20:00:49 localhost kernel: x86/PAT: Configuration [0-7]: WB WC UC- UC WB WP UC- WT Mar 09 20:00:49 localhost kernel: last_pfn = 0xbffdb max_arch_pfn = 0x400000000 Mar 09 20:00:49 localhost kernel: found SMP MP-table at [mem 0x000f5ae0-0x000f5aef] Mar 09 20:00:49 localhost kernel: Using GB pages for direct mapping Mar 09 20:00:49 localhost kernel: RAMDISK: [mem 0x1b6b6000-0x29b52fff] Mar 09 20:00:49 localhost kernel: ACPI: Early table checksum verification disabled Mar 09 20:00:49 localhost kernel: ACPI: RSDP 0x00000000000F5AA0 000014 (v00 BOCHS ) Mar 09 20:00:49 localhost kernel: ACPI: RSDT 0x00000000BFFE16BD 000030 (v01 BOCHS BXPC 00000001 BXPC 00000001) Mar 09 20:00:49 localhost kernel: ACPI: FACP 0x00000000BFFE1571 000074 (v01 BOCHS BXPC 00000001 BXPC 00000001) Mar 09 20:00:49 localhost kernel: ACPI: DSDT 0x00000000BFFDFC80 0018F1 (v01 BOCHS BXPC 00000001 BXPC 00000001) Mar 09 20:00:49 localhost kernel: ACPI: FACS 0x00000000BFFDFC40 000040 Mar 09 20:00:49 localhost kernel: ACPI: APIC 0x00000000BFFE15E5 0000B0 (v01 BOCHS BXPC 00000001 BXPC 00000001) Mar 09 20:00:49 localhost kernel: ACPI: WAET 0x00000000BFFE1695 000028 (v01 BOCHS BXPC 00000001 BXPC 00000001) Mar 09 20:00:49 localhost kernel: ACPI: Reserving FACP table memory at [mem 0xbffe1571-0xbffe15e4] Mar 09 20:00:49 localhost kernel: ACPI: Reserving DSDT table memory at [mem 0xbffdfc80-0xbffe1570] Mar 09 20:00:49 localhost kernel: ACPI: Reserving FACS table memory at [mem 0xbffdfc40-0xbffdfc7f] Mar 09 20:00:49 localhost kernel: ACPI: Reserving APIC table memory at [mem 0xbffe15e5-0xbffe1694] Mar 09 20:00:49 localhost kernel: ACPI: Reserving WAET table memory at [mem 0xbffe1695-0xbffe16bc] Mar 09 20:00:49 localhost kernel: No NUMA configuration found Mar 09 20:00:49 localhost kernel: Faking a node at [mem 0x0000000000000000-0x000000023fffffff] Mar 09 20:00:49 localhost kernel: NODE_DATA(0) allocated [mem 0x23ffd5000-0x23fffffff] Mar 09 20:00:49 localhost kernel: crashkernel reserved: 0x00000000af000000 - 0x00000000bf000000 (256 MB) Mar 09 20:00:49 localhost kernel: Zone ranges: Mar 09 20:00:49 localhost kernel: DMA [mem 0x0000000000001000-0x0000000000ffffff] Mar 09 20:00:49 localhost kernel: DMA32 [mem 0x0000000001000000-0x00000000ffffffff] Mar 09 20:00:49 localhost kernel: Normal [mem 0x0000000100000000-0x000000023fffffff] Mar 09 20:00:49 localhost kernel: Device empty Mar 09 20:00:49 localhost kernel: Movable zone start for each node Mar 09 20:00:49 localhost kernel: Early memory node ranges Mar 09 20:00:49 localhost kernel: node 0: [mem 0x0000000000001000-0x000000000009efff] Mar 09 20:00:49 localhost kernel: node 0: [mem 0x0000000000100000-0x00000000bffdafff] Mar 09 20:00:49 localhost kernel: node 0: [mem 0x0000000100000000-0x000000023fffffff] Mar 09 20:00:49 localhost kernel: Initmem setup node 0 [mem 0x0000000000001000-0x000000023fffffff] Mar 09 20:00:49 localhost kernel: On node 0, zone DMA: 1 pages in unavailable ranges Mar 09 20:00:49 localhost kernel: On node 0, zone DMA: 97 pages in unavailable ranges Mar 09 20:00:49 localhost kernel: On node 0, zone Normal: 37 pages in unavailable ranges Mar 09 20:00:49 localhost kernel: ACPI: PM-Timer IO Port: 0x608 Mar 09 20:00:49 localhost kernel: ACPI: LAPIC_NMI (acpi_id[0xff] dfl dfl lint[0x1]) Mar 09 20:00:49 localhost kernel: IOAPIC[0]: apic_id 0, version 17, address 0xfec00000, GSI 0-23 Mar 09 20:00:49 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl) Mar 09 20:00:49 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 5 global_irq 5 high level) Mar 09 20:00:49 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level) Mar 09 20:00:49 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 10 global_irq 10 high level) Mar 09 20:00:49 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 11 global_irq 11 high level) Mar 09 20:00:49 localhost kernel: ACPI: Using ACPI (MADT) for SMP configuration information Mar 09 20:00:49 localhost kernel: TSC deadline timer available Mar 09 20:00:49 localhost kernel: CPU topo: Max. logical packages: 8 Mar 09 20:00:49 localhost kernel: CPU topo: Max. logical dies: 8 Mar 09 20:00:49 localhost kernel: CPU topo: Max. dies per package: 1 Mar 09 20:00:49 localhost kernel: CPU topo: Max. threads per core: 1 Mar 09 20:00:49 localhost kernel: CPU topo: Num. cores per package: 1 Mar 09 20:00:49 localhost kernel: CPU topo: Num. threads per package: 1 Mar 09 20:00:49 localhost kernel: CPU topo: Allowing 8 present CPUs plus 0 hotplug CPUs Mar 09 20:00:49 localhost kernel: kvm-guest: APIC: eoi() replaced with kvm_guest_apic_eoi_write() Mar 09 20:00:49 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0x00000000-0x00000fff] Mar 09 20:00:49 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0x0009f000-0x0009ffff] Mar 09 20:00:49 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0x000a0000-0x000effff] Mar 09 20:00:49 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0x000f0000-0x000fffff] Mar 09 20:00:49 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xbffdb000-0xbfffffff] Mar 09 20:00:49 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xc0000000-0xfeffbfff] Mar 09 20:00:49 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xfeffc000-0xfeffffff] Mar 09 20:00:49 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xff000000-0xfffbffff] Mar 09 20:00:49 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xfffc0000-0xffffffff] Mar 09 20:00:49 localhost kernel: [mem 0xc0000000-0xfeffbfff] available for PCI devices Mar 09 20:00:49 localhost kernel: Booting paravirtualized kernel on KVM Mar 09 20:00:49 localhost kernel: clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1910969940391419 ns Mar 09 20:00:49 localhost kernel: setup_percpu: NR_CPUS:8192 nr_cpumask_bits:8 nr_cpu_ids:8 nr_node_ids:1 Mar 09 20:00:49 localhost kernel: percpu: Embedded 64 pages/cpu s225280 r8192 d28672 u262144 Mar 09 20:00:49 localhost kernel: pcpu-alloc: s225280 r8192 d28672 u262144 alloc=1*2097152 Mar 09 20:00:49 localhost kernel: pcpu-alloc: [0] 0 1 2 3 4 5 6 7 Mar 09 20:00:49 localhost kernel: kvm-guest: PV spinlocks disabled, no host support Mar 09 20:00:49 localhost kernel: Kernel command line: BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-687.el9.x86_64 root=UUID=d70e3b08-39eb-4644-ba12-579a10c34a4e ro console=ttyS0,115200n8 no_timer_check net.ifnames=0 crashkernel=1G-2G:192M,2G-64G:256M,64G-:512M Mar 09 20:00:49 localhost kernel: Unknown kernel command line parameters "BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-687.el9.x86_64", will be passed to user space. Mar 09 20:00:49 localhost kernel: random: crng init done Mar 09 20:00:49 localhost kernel: Dentry cache hash table entries: 1048576 (order: 11, 8388608 bytes, linear) Mar 09 20:00:49 localhost kernel: Inode-cache hash table entries: 524288 (order: 10, 4194304 bytes, linear) Mar 09 20:00:49 localhost kernel: Fallback order for Node 0: 0 Mar 09 20:00:49 localhost kernel: Built 1 zonelists, mobility grouping on. Total pages: 2064091 Mar 09 20:00:49 localhost kernel: Policy zone: Normal Mar 09 20:00:49 localhost kernel: mem auto-init: stack:off, heap alloc:off, heap free:off Mar 09 20:00:49 localhost kernel: software IO TLB: area num 8. Mar 09 20:00:49 localhost kernel: SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=8, Nodes=1 Mar 09 20:00:49 localhost kernel: ftrace: allocating 49605 entries in 194 pages Mar 09 20:00:49 localhost kernel: ftrace: allocated 194 pages with 3 groups Mar 09 20:00:49 localhost kernel: Dynamic Preempt: voluntary Mar 09 20:00:49 localhost kernel: rcu: Preemptible hierarchical RCU implementation. Mar 09 20:00:49 localhost kernel: rcu: RCU event tracing is enabled. Mar 09 20:00:49 localhost kernel: rcu: RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=8. Mar 09 20:00:49 localhost kernel: Trampoline variant of Tasks RCU enabled. Mar 09 20:00:49 localhost kernel: Rude variant of Tasks RCU enabled. Mar 09 20:00:49 localhost kernel: Tracing variant of Tasks RCU enabled. Mar 09 20:00:49 localhost kernel: rcu: RCU calculated value of scheduler-enlistment delay is 100 jiffies. Mar 09 20:00:49 localhost kernel: rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=8 Mar 09 20:00:49 localhost kernel: RCU Tasks: Setting shift to 3 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=8. Mar 09 20:00:49 localhost kernel: RCU Tasks Rude: Setting shift to 3 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=8. Mar 09 20:00:49 localhost kernel: RCU Tasks Trace: Setting shift to 3 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=8. Mar 09 20:00:49 localhost kernel: NR_IRQS: 524544, nr_irqs: 488, preallocated irqs: 16 Mar 09 20:00:49 localhost kernel: rcu: srcu_init: Setting srcu_struct sizes based on contention. Mar 09 20:00:49 localhost kernel: kfence: initialized - using 2097152 bytes for 255 objects at 0x(____ptrval____)-0x(____ptrval____) Mar 09 20:00:49 localhost kernel: Console: colour VGA+ 80x25 Mar 09 20:00:49 localhost kernel: printk: console [ttyS0] enabled Mar 09 20:00:49 localhost kernel: ACPI: Core revision 20230331 Mar 09 20:00:49 localhost kernel: APIC: Switch to symmetric I/O mode setup Mar 09 20:00:49 localhost kernel: x2apic enabled Mar 09 20:00:49 localhost kernel: APIC: Switched APIC routing to: physical x2apic Mar 09 20:00:49 localhost kernel: tsc: Marking TSC unstable due to TSCs unsynchronized Mar 09 20:00:49 localhost kernel: Calibrating delay loop (skipped) preset value.. 5599.99 BogoMIPS (lpj=2799998) Mar 09 20:00:49 localhost kernel: x86/cpu: User Mode Instruction Prevention (UMIP) activated Mar 09 20:00:49 localhost kernel: Last level iTLB entries: 4KB 512, 2MB 255, 4MB 127 Mar 09 20:00:49 localhost kernel: Last level dTLB entries: 4KB 512, 2MB 255, 4MB 127, 1GB 0 Mar 09 20:00:49 localhost kernel: mitigations: Enabled attack vectors: user_kernel, user_user, guest_host, guest_guest, SMT mitigations: auto Mar 09 20:00:49 localhost kernel: Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl Mar 09 20:00:49 localhost kernel: Spectre V2 : Mitigation: Retpolines Mar 09 20:00:49 localhost kernel: RETBleed: Mitigation: untrained return thunk Mar 09 20:00:49 localhost kernel: Speculative Return Stack Overflow: Mitigation: SMT disabled Mar 09 20:00:49 localhost kernel: Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization Mar 09 20:00:49 localhost kernel: Spectre V2 : Spectre v2 / SpectreRSB: Filling RSB on context switch and VMEXIT Mar 09 20:00:49 localhost kernel: Spectre V2 : Enabling Speculation Barrier for firmware calls Mar 09 20:00:49 localhost kernel: active return thunk: retbleed_return_thunk Mar 09 20:00:49 localhost kernel: Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier Mar 09 20:00:49 localhost kernel: x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers' Mar 09 20:00:49 localhost kernel: x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers' Mar 09 20:00:49 localhost kernel: x86/fpu: Supporting XSAVE feature 0x004: 'AVX registers' Mar 09 20:00:49 localhost kernel: x86/fpu: xstate_offset[2]: 576, xstate_sizes[2]: 256 Mar 09 20:00:49 localhost kernel: x86/fpu: Enabled xstate features 0x7, context size is 832 bytes, using 'compacted' format. Mar 09 20:00:49 localhost kernel: Freeing SMP alternatives memory: 40K Mar 09 20:00:49 localhost kernel: pid_max: default: 32768 minimum: 301 Mar 09 20:00:49 localhost kernel: LSM: initializing lsm=lockdown,capability,landlock,yama,integrity,selinux,bpf Mar 09 20:00:49 localhost kernel: landlock: Up and running. Mar 09 20:00:49 localhost kernel: Yama: becoming mindful. Mar 09 20:00:49 localhost kernel: SELinux: Initializing. Mar 09 20:00:49 localhost kernel: LSM support for eBPF active Mar 09 20:00:49 localhost kernel: Mount-cache hash table entries: 16384 (order: 5, 131072 bytes, linear) Mar 09 20:00:49 localhost kernel: Mountpoint-cache hash table entries: 16384 (order: 5, 131072 bytes, linear) Mar 09 20:00:49 localhost kernel: smpboot: CPU0: AMD EPYC-Rome Processor (family: 0x17, model: 0x31, stepping: 0x0) Mar 09 20:00:49 localhost kernel: Performance Events: Fam17h+ core perfctr, AMD PMU driver. Mar 09 20:00:49 localhost kernel: ... version: 0 Mar 09 20:00:49 localhost kernel: ... bit width: 48 Mar 09 20:00:49 localhost kernel: ... generic registers: 6 Mar 09 20:00:49 localhost kernel: ... value mask: 0000ffffffffffff Mar 09 20:00:49 localhost kernel: ... max period: 00007fffffffffff Mar 09 20:00:49 localhost kernel: ... fixed-purpose events: 0 Mar 09 20:00:49 localhost kernel: ... event mask: 000000000000003f Mar 09 20:00:49 localhost kernel: signal: max sigframe size: 1776 Mar 09 20:00:49 localhost kernel: rcu: Hierarchical SRCU implementation. Mar 09 20:00:49 localhost kernel: rcu: Max phase no-delay instances is 400. Mar 09 20:00:49 localhost kernel: smp: Bringing up secondary CPUs ... Mar 09 20:00:49 localhost kernel: smpboot: x86: Booting SMP configuration: Mar 09 20:00:49 localhost kernel: .... node #0, CPUs: #1 #2 #3 #4 #5 #6 #7 Mar 09 20:00:49 localhost kernel: smp: Brought up 1 node, 8 CPUs Mar 09 20:00:49 localhost kernel: smpboot: Total of 8 processors activated (44799.96 BogoMIPS) Mar 09 20:00:49 localhost kernel: node 0 deferred pages initialised in 10ms Mar 09 20:00:49 localhost kernel: Memory: 7617592K/8388068K available (16384K kernel code, 5797K rwdata, 13956K rodata, 4204K init, 7172K bss, 764500K reserved, 0K cma-reserved) Mar 09 20:00:49 localhost kernel: devtmpfs: initialized Mar 09 20:00:49 localhost kernel: x86/mm: Memory block size: 128MB Mar 09 20:00:49 localhost kernel: clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1911260446275000 ns Mar 09 20:00:49 localhost kernel: futex hash table entries: 2048 (131072 bytes on 1 NUMA nodes, total 128 KiB, linear). Mar 09 20:00:49 localhost kernel: pinctrl core: initialized pinctrl subsystem Mar 09 20:00:49 localhost kernel: NET: Registered PF_NETLINK/PF_ROUTE protocol family Mar 09 20:00:49 localhost kernel: DMA: preallocated 1024 KiB GFP_KERNEL pool for atomic allocations Mar 09 20:00:49 localhost kernel: DMA: preallocated 1024 KiB GFP_KERNEL|GFP_DMA pool for atomic allocations Mar 09 20:00:49 localhost kernel: DMA: preallocated 1024 KiB GFP_KERNEL|GFP_DMA32 pool for atomic allocations Mar 09 20:00:49 localhost kernel: audit: initializing netlink subsys (disabled) Mar 09 20:00:49 localhost kernel: audit: type=2000 audit(1773100847.847:1): state=initialized audit_enabled=0 res=1 Mar 09 20:00:49 localhost kernel: thermal_sys: Registered thermal governor 'fair_share' Mar 09 20:00:49 localhost kernel: thermal_sys: Registered thermal governor 'step_wise' Mar 09 20:00:49 localhost kernel: thermal_sys: Registered thermal governor 'user_space' Mar 09 20:00:49 localhost kernel: cpuidle: using governor menu Mar 09 20:00:49 localhost kernel: acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5 Mar 09 20:00:49 localhost kernel: PCI: Using configuration type 1 for base access Mar 09 20:00:49 localhost kernel: PCI: Using configuration type 1 for extended access Mar 09 20:00:49 localhost kernel: kprobes: kprobe jump-optimization is enabled. All kprobes are optimized if possible. Mar 09 20:00:49 localhost kernel: HugeTLB: registered 1.00 GiB page size, pre-allocated 0 pages Mar 09 20:00:49 localhost kernel: HugeTLB: 16380 KiB vmemmap can be freed for a 1.00 GiB page Mar 09 20:00:49 localhost kernel: HugeTLB: registered 2.00 MiB page size, pre-allocated 0 pages Mar 09 20:00:49 localhost kernel: HugeTLB: 28 KiB vmemmap can be freed for a 2.00 MiB page Mar 09 20:00:49 localhost kernel: Demotion targets for Node 0: null Mar 09 20:00:49 localhost kernel: cryptd: max_cpu_qlen set to 1000 Mar 09 20:00:49 localhost kernel: ACPI: Added _OSI(Module Device) Mar 09 20:00:49 localhost kernel: ACPI: Added _OSI(Processor Device) Mar 09 20:00:49 localhost kernel: ACPI: Added _OSI(Processor Aggregator Device) Mar 09 20:00:49 localhost kernel: ACPI: 1 ACPI AML tables successfully acquired and loaded Mar 09 20:00:49 localhost kernel: ACPI: Interpreter enabled Mar 09 20:00:49 localhost kernel: ACPI: PM: (supports S0 S3 S4 S5) Mar 09 20:00:49 localhost kernel: ACPI: Using IOAPIC for interrupt routing Mar 09 20:00:49 localhost kernel: PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug Mar 09 20:00:49 localhost kernel: PCI: Using E820 reservations for host bridge windows Mar 09 20:00:49 localhost kernel: ACPI: Enabled 2 GPEs in block 00 to 0F Mar 09 20:00:49 localhost kernel: ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff]) Mar 09 20:00:49 localhost kernel: acpi PNP0A03:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI EDR HPX-Type3] Mar 09 20:00:49 localhost kernel: acpiphp: Slot [3] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [4] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [5] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [6] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [7] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [8] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [9] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [10] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [11] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [12] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [13] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [14] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [15] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [16] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [17] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [18] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [19] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [20] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [21] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [22] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [23] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [24] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [25] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [26] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [27] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [28] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [29] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [30] registered Mar 09 20:00:49 localhost kernel: acpiphp: Slot [31] registered Mar 09 20:00:49 localhost kernel: PCI host bridge to bus 0000:00 Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: root bus resource [io 0x0000-0x0cf7 window] Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: root bus resource [io 0x0d00-0xffff window] Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window] Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: root bus resource [mem 0xc0000000-0xfebfffff window] Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: root bus resource [mem 0x240000000-0x2bfffffff window] Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: root bus resource [bus 00-ff] Mar 09 20:00:49 localhost kernel: pci 0000:00:00.0: [8086:1237] type 00 class 0x060000 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:01.0: [8086:7000] type 00 class 0x060100 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:01.1: [8086:7010] type 00 class 0x010180 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:01.1: BAR 4 [io 0xc140-0xc14f] Mar 09 20:00:49 localhost kernel: pci 0000:00:01.1: BAR 0 [io 0x01f0-0x01f7]: legacy IDE quirk Mar 09 20:00:49 localhost kernel: pci 0000:00:01.1: BAR 1 [io 0x03f6]: legacy IDE quirk Mar 09 20:00:49 localhost kernel: pci 0000:00:01.1: BAR 2 [io 0x0170-0x0177]: legacy IDE quirk Mar 09 20:00:49 localhost kernel: pci 0000:00:01.1: BAR 3 [io 0x0376]: legacy IDE quirk Mar 09 20:00:49 localhost kernel: pci 0000:00:01.2: [8086:7020] type 00 class 0x0c0300 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:01.2: BAR 4 [io 0xc100-0xc11f] Mar 09 20:00:49 localhost kernel: pci 0000:00:01.3: [8086:7113] type 00 class 0x068000 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:01.3: quirk: [io 0x0600-0x063f] claimed by PIIX4 ACPI Mar 09 20:00:49 localhost kernel: pci 0000:00:01.3: quirk: [io 0x0700-0x070f] claimed by PIIX4 SMB Mar 09 20:00:49 localhost kernel: pci 0000:00:02.0: [1af4:1050] type 00 class 0x030000 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:02.0: BAR 0 [mem 0xfe000000-0xfe7fffff pref] Mar 09 20:00:49 localhost kernel: pci 0000:00:02.0: BAR 2 [mem 0xfe800000-0xfe803fff 64bit pref] Mar 09 20:00:49 localhost kernel: pci 0000:00:02.0: BAR 4 [mem 0xfeb90000-0xfeb90fff] Mar 09 20:00:49 localhost kernel: pci 0000:00:02.0: ROM [mem 0xfeb80000-0xfeb8ffff pref] Mar 09 20:00:49 localhost kernel: pci 0000:00:02.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff] Mar 09 20:00:49 localhost kernel: pci 0000:00:03.0: [1af4:1000] type 00 class 0x020000 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:03.0: BAR 0 [io 0xc080-0xc0bf] Mar 09 20:00:49 localhost kernel: pci 0000:00:03.0: BAR 1 [mem 0xfeb91000-0xfeb91fff] Mar 09 20:00:49 localhost kernel: pci 0000:00:03.0: BAR 4 [mem 0xfe804000-0xfe807fff 64bit pref] Mar 09 20:00:49 localhost kernel: pci 0000:00:03.0: ROM [mem 0xfeb00000-0xfeb7ffff pref] Mar 09 20:00:49 localhost kernel: pci 0000:00:04.0: [1af4:1001] type 00 class 0x010000 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:04.0: BAR 0 [io 0xc000-0xc07f] Mar 09 20:00:49 localhost kernel: pci 0000:00:04.0: BAR 1 [mem 0xfeb92000-0xfeb92fff] Mar 09 20:00:49 localhost kernel: pci 0000:00:04.0: BAR 4 [mem 0xfe808000-0xfe80bfff 64bit pref] Mar 09 20:00:49 localhost kernel: pci 0000:00:05.0: [1af4:1002] type 00 class 0x00ff00 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:05.0: BAR 0 [io 0xc0c0-0xc0ff] Mar 09 20:00:49 localhost kernel: pci 0000:00:05.0: BAR 4 [mem 0xfe80c000-0xfe80ffff 64bit pref] Mar 09 20:00:49 localhost kernel: pci 0000:00:06.0: [1af4:1005] type 00 class 0x00ff00 conventional PCI endpoint Mar 09 20:00:49 localhost kernel: pci 0000:00:06.0: BAR 0 [io 0xc120-0xc13f] Mar 09 20:00:49 localhost kernel: pci 0000:00:06.0: BAR 4 [mem 0xfe810000-0xfe813fff 64bit pref] Mar 09 20:00:49 localhost kernel: ACPI: PCI: Interrupt link LNKA configured for IRQ 10 Mar 09 20:00:49 localhost kernel: ACPI: PCI: Interrupt link LNKB configured for IRQ 10 Mar 09 20:00:49 localhost kernel: ACPI: PCI: Interrupt link LNKC configured for IRQ 11 Mar 09 20:00:49 localhost kernel: ACPI: PCI: Interrupt link LNKD configured for IRQ 11 Mar 09 20:00:49 localhost kernel: ACPI: PCI: Interrupt link LNKS configured for IRQ 9 Mar 09 20:00:49 localhost kernel: iommu: Default domain type: Translated Mar 09 20:00:49 localhost kernel: iommu: DMA domain TLB invalidation policy: lazy mode Mar 09 20:00:49 localhost kernel: SCSI subsystem initialized Mar 09 20:00:49 localhost kernel: ACPI: bus type USB registered Mar 09 20:00:49 localhost kernel: usbcore: registered new interface driver usbfs Mar 09 20:00:49 localhost kernel: usbcore: registered new interface driver hub Mar 09 20:00:49 localhost kernel: usbcore: registered new device driver usb Mar 09 20:00:49 localhost kernel: pps_core: LinuxPPS API ver. 1 registered Mar 09 20:00:49 localhost kernel: pps_core: Software ver. 5.3.6 - Copyright 2005-2007 Rodolfo Giometti Mar 09 20:00:49 localhost kernel: PTP clock support registered Mar 09 20:00:49 localhost kernel: EDAC MC: Ver: 3.0.0 Mar 09 20:00:49 localhost kernel: NetLabel: Initializing Mar 09 20:00:49 localhost kernel: NetLabel: domain hash size = 128 Mar 09 20:00:49 localhost kernel: NetLabel: protocols = UNLABELED CIPSOv4 CALIPSO Mar 09 20:00:49 localhost kernel: NetLabel: unlabeled traffic allowed by default Mar 09 20:00:49 localhost kernel: PCI: Using ACPI for IRQ routing Mar 09 20:00:49 localhost kernel: PCI: pci_cache_line_size set to 64 bytes Mar 09 20:00:49 localhost kernel: e820: reserve RAM buffer [mem 0x0009fc00-0x0009ffff] Mar 09 20:00:49 localhost kernel: e820: reserve RAM buffer [mem 0xbffdb000-0xbfffffff] Mar 09 20:00:49 localhost kernel: pci 0000:00:02.0: vgaarb: setting as boot VGA device Mar 09 20:00:49 localhost kernel: pci 0000:00:02.0: vgaarb: bridge control possible Mar 09 20:00:49 localhost kernel: pci 0000:00:02.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none Mar 09 20:00:49 localhost kernel: vgaarb: loaded Mar 09 20:00:49 localhost kernel: clocksource: Switched to clocksource kvm-clock Mar 09 20:00:49 localhost kernel: VFS: Disk quotas dquot_6.6.0 Mar 09 20:00:49 localhost kernel: VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes) Mar 09 20:00:49 localhost kernel: pnp: PnP ACPI init Mar 09 20:00:49 localhost kernel: pnp 00:03: [dma 2] Mar 09 20:00:49 localhost kernel: pnp: PnP ACPI: found 5 devices Mar 09 20:00:49 localhost kernel: clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns Mar 09 20:00:49 localhost kernel: NET: Registered PF_INET protocol family Mar 09 20:00:49 localhost kernel: IP idents hash table entries: 131072 (order: 8, 1048576 bytes, linear) Mar 09 20:00:49 localhost kernel: tcp_listen_portaddr_hash hash table entries: 4096 (order: 4, 65536 bytes, linear) Mar 09 20:00:49 localhost kernel: Table-perturb hash table entries: 65536 (order: 6, 262144 bytes, linear) Mar 09 20:00:49 localhost kernel: TCP established hash table entries: 65536 (order: 7, 524288 bytes, linear) Mar 09 20:00:49 localhost kernel: TCP bind hash table entries: 65536 (order: 8, 1048576 bytes, linear) Mar 09 20:00:49 localhost kernel: TCP: Hash tables configured (established 65536 bind 65536) Mar 09 20:00:49 localhost kernel: MPTCP token hash table entries: 8192 (order: 5, 196608 bytes, linear) Mar 09 20:00:49 localhost kernel: UDP hash table entries: 4096 (order: 5, 131072 bytes, linear) Mar 09 20:00:49 localhost kernel: UDP-Lite hash table entries: 4096 (order: 5, 131072 bytes, linear) Mar 09 20:00:49 localhost kernel: NET: Registered PF_UNIX/PF_LOCAL protocol family Mar 09 20:00:49 localhost kernel: NET: Registered PF_XDP protocol family Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: resource 4 [io 0x0000-0x0cf7 window] Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: resource 5 [io 0x0d00-0xffff window] Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: resource 6 [mem 0x000a0000-0x000bffff window] Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: resource 7 [mem 0xc0000000-0xfebfffff window] Mar 09 20:00:49 localhost kernel: pci_bus 0000:00: resource 8 [mem 0x240000000-0x2bfffffff window] Mar 09 20:00:49 localhost kernel: pci 0000:00:01.0: PIIX3: Enabling Passive Release Mar 09 20:00:49 localhost kernel: pci 0000:00:00.0: Limiting direct PCI/PCI transfers Mar 09 20:00:49 localhost kernel: ACPI: \_SB_.LNKD: Enabled at IRQ 11 Mar 09 20:00:49 localhost kernel: pci 0000:00:01.2: quirk_usb_early_handoff+0x0/0x160 took 33035 usecs Mar 09 20:00:49 localhost kernel: PCI: CLS 0 bytes, default 64 Mar 09 20:00:49 localhost kernel: PCI-DMA: Using software bounce buffering for IO (SWIOTLB) Mar 09 20:00:49 localhost kernel: software IO TLB: mapped [mem 0x00000000ab000000-0x00000000af000000] (64MB) Mar 09 20:00:49 localhost kernel: ACPI: bus type thunderbolt registered Mar 09 20:00:49 localhost kernel: Trying to unpack rootfs image as initramfs... Mar 09 20:00:49 localhost kernel: Initialise system trusted keyrings Mar 09 20:00:49 localhost kernel: Key type blacklist registered Mar 09 20:00:49 localhost kernel: workingset: timestamp_bits=36 max_order=21 bucket_order=0 Mar 09 20:00:49 localhost kernel: zbud: loaded Mar 09 20:00:49 localhost kernel: integrity: Platform Keyring initialized Mar 09 20:00:49 localhost kernel: integrity: Machine keyring initialized Mar 09 20:00:49 localhost kernel: Freeing initrd memory: 234100K Mar 09 20:00:49 localhost kernel: NET: Registered PF_ALG protocol family Mar 09 20:00:49 localhost kernel: xor: automatically using best checksumming function avx Mar 09 20:00:49 localhost kernel: Key type asymmetric registered Mar 09 20:00:49 localhost kernel: Asymmetric key parser 'x509' registered Mar 09 20:00:49 localhost kernel: Block layer SCSI generic (bsg) driver version 0.4 loaded (major 246) Mar 09 20:00:49 localhost kernel: io scheduler mq-deadline registered Mar 09 20:00:49 localhost kernel: io scheduler kyber registered Mar 09 20:00:49 localhost kernel: io scheduler bfq registered Mar 09 20:00:49 localhost kernel: atomic64_test: passed for x86-64 platform with CX8 and with SSE Mar 09 20:00:49 localhost kernel: shpchp: Standard Hot Plug PCI Controller Driver version: 0.4 Mar 09 20:00:49 localhost kernel: input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input0 Mar 09 20:00:49 localhost kernel: ACPI: button: Power Button [PWRF] Mar 09 20:00:49 localhost kernel: ACPI: \_SB_.LNKB: Enabled at IRQ 10 Mar 09 20:00:49 localhost kernel: ACPI: \_SB_.LNKC: Enabled at IRQ 11 Mar 09 20:00:49 localhost kernel: ACPI: \_SB_.LNKA: Enabled at IRQ 10 Mar 09 20:00:49 localhost kernel: Serial: 8250/16550 driver, 4 ports, IRQ sharing enabled Mar 09 20:00:49 localhost kernel: 00:00: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A Mar 09 20:00:49 localhost kernel: Non-volatile memory driver v1.3 Mar 09 20:00:49 localhost kernel: rdac: device handler registered Mar 09 20:00:49 localhost kernel: hp_sw: device handler registered Mar 09 20:00:49 localhost kernel: emc: device handler registered Mar 09 20:00:49 localhost kernel: alua: device handler registered Mar 09 20:00:49 localhost kernel: uhci_hcd 0000:00:01.2: UHCI Host Controller Mar 09 20:00:49 localhost kernel: uhci_hcd 0000:00:01.2: new USB bus registered, assigned bus number 1 Mar 09 20:00:49 localhost kernel: uhci_hcd 0000:00:01.2: detected 2 ports Mar 09 20:00:49 localhost kernel: uhci_hcd 0000:00:01.2: irq 11, io port 0x0000c100 Mar 09 20:00:49 localhost kernel: usb usb1: New USB device found, idVendor=1d6b, idProduct=0001, bcdDevice= 5.14 Mar 09 20:00:49 localhost kernel: usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1 Mar 09 20:00:49 localhost kernel: usb usb1: Product: UHCI Host Controller Mar 09 20:00:49 localhost kernel: usb usb1: Manufacturer: Linux 5.14.0-687.el9.x86_64 uhci_hcd Mar 09 20:00:49 localhost kernel: usb usb1: SerialNumber: 0000:00:01.2 Mar 09 20:00:49 localhost kernel: hub 1-0:1.0: USB hub found Mar 09 20:00:49 localhost kernel: hub 1-0:1.0: 2 ports detected Mar 09 20:00:49 localhost kernel: usbcore: registered new interface driver usbserial_generic Mar 09 20:00:49 localhost kernel: usbserial: USB Serial support registered for generic Mar 09 20:00:49 localhost kernel: i8042: PNP: PS/2 Controller [PNP0303:KBD,PNP0f13:MOU] at 0x60,0x64 irq 1,12 Mar 09 20:00:49 localhost kernel: serio: i8042 KBD port at 0x60,0x64 irq 1 Mar 09 20:00:49 localhost kernel: serio: i8042 AUX port at 0x60,0x64 irq 12 Mar 09 20:00:49 localhost kernel: mousedev: PS/2 mouse device common for all mice Mar 09 20:00:49 localhost kernel: rtc_cmos 00:04: RTC can wake from S4 Mar 09 20:00:49 localhost kernel: rtc_cmos 00:04: registered as rtc0 Mar 09 20:00:49 localhost kernel: input: AT Translated Set 2 keyboard as /devices/platform/i8042/serio0/input/input1 Mar 09 20:00:49 localhost kernel: rtc_cmos 00:04: setting system clock to 2026-03-10T00:00:48 UTC (1773100848) Mar 09 20:00:49 localhost kernel: rtc_cmos 00:04: alarms up to one day, y3k, 242 bytes nvram Mar 09 20:00:49 localhost kernel: amd_pstate: the _CPC object is not present in SBIOS or ACPI disabled Mar 09 20:00:49 localhost kernel: hid: raw HID events driver (C) Jiri Kosina Mar 09 20:00:49 localhost kernel: usbcore: registered new interface driver usbhid Mar 09 20:00:49 localhost kernel: usbhid: USB HID core driver Mar 09 20:00:49 localhost kernel: drop_monitor: Initializing network drop monitor service Mar 09 20:00:49 localhost kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input4 Mar 09 20:00:49 localhost kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input3 Mar 09 20:00:49 localhost kernel: Initializing XFRM netlink socket Mar 09 20:00:49 localhost kernel: NET: Registered PF_INET6 protocol family Mar 09 20:00:49 localhost kernel: Segment Routing with IPv6 Mar 09 20:00:49 localhost kernel: NET: Registered PF_PACKET protocol family Mar 09 20:00:49 localhost kernel: mpls_gso: MPLS GSO support Mar 09 20:00:49 localhost kernel: IPI shorthand broadcast: enabled Mar 09 20:00:49 localhost kernel: AVX2 version of gcm_enc/dec engaged. Mar 09 20:00:49 localhost kernel: AES CTR mode by8 optimization enabled Mar 09 20:00:49 localhost kernel: sched_clock: Marking stable (1185001861, 144802242)->(1395064768, -65260665) Mar 09 20:00:49 localhost kernel: registered taskstats version 1 Mar 09 20:00:49 localhost kernel: Loading compiled-in X.509 certificates Mar 09 20:00:49 localhost kernel: Loaded X.509 cert 'The CentOS Project: CentOS Stream kernel signing key: fea3310e757009fdf4938aef125dfb5a1f0e3bc0' Mar 09 20:00:49 localhost kernel: Loaded X.509 cert 'Red Hat Enterprise Linux Driver Update Program (key 3): bf57f3e87362bc7229d9f465321773dfd1f77a80' Mar 09 20:00:49 localhost kernel: Loaded X.509 cert 'Red Hat Enterprise Linux kpatch signing key: 4d38fd864ebe18c5f0b72e3852e2014c3a676fc8' Mar 09 20:00:49 localhost kernel: Loaded X.509 cert 'RH-IMA-CA: Red Hat IMA CA: fb31825dd0e073685b264e3038963673f753959a' Mar 09 20:00:49 localhost kernel: Loaded X.509 cert 'Nvidia GPU OOT signing 001: 55e1cef88193e60419f0b0ec379c49f77545acf0' Mar 09 20:00:49 localhost kernel: Demotion targets for Node 0: null Mar 09 20:00:49 localhost kernel: page_owner is disabled Mar 09 20:00:49 localhost kernel: Key type .fscrypt registered Mar 09 20:00:49 localhost kernel: Key type fscrypt-provisioning registered Mar 09 20:00:49 localhost kernel: Key type big_key registered Mar 09 20:00:49 localhost kernel: Key type encrypted registered Mar 09 20:00:49 localhost kernel: ima: No TPM chip found, activating TPM-bypass! Mar 09 20:00:49 localhost kernel: Loading compiled-in module X.509 certificates Mar 09 20:00:49 localhost kernel: Loaded X.509 cert 'The CentOS Project: CentOS Stream kernel signing key: fea3310e757009fdf4938aef125dfb5a1f0e3bc0' Mar 09 20:00:49 localhost kernel: ima: Allocated hash algorithm: sha256 Mar 09 20:00:49 localhost kernel: ima: No architecture policies found Mar 09 20:00:49 localhost kernel: evm: Initialising EVM extended attributes: Mar 09 20:00:49 localhost kernel: evm: security.selinux Mar 09 20:00:49 localhost kernel: evm: security.SMACK64 (disabled) Mar 09 20:00:49 localhost kernel: evm: security.SMACK64EXEC (disabled) Mar 09 20:00:49 localhost kernel: evm: security.SMACK64TRANSMUTE (disabled) Mar 09 20:00:49 localhost kernel: evm: security.SMACK64MMAP (disabled) Mar 09 20:00:49 localhost kernel: evm: security.apparmor (disabled) Mar 09 20:00:49 localhost kernel: evm: security.ima Mar 09 20:00:49 localhost kernel: evm: security.capability Mar 09 20:00:49 localhost kernel: evm: HMAC attrs: 0x1 Mar 09 20:00:49 localhost kernel: usb 1-1: new full-speed USB device number 2 using uhci_hcd Mar 09 20:00:49 localhost kernel: Running certificate verification RSA selftest Mar 09 20:00:49 localhost kernel: Loaded X.509 cert 'Certificate verification self-testing key: f58703bb33ce1b73ee02eccdee5b8817518fe3db' Mar 09 20:00:49 localhost kernel: Running certificate verification ECDSA selftest Mar 09 20:00:49 localhost kernel: Loaded X.509 cert 'Certificate verification ECDSA self-testing key: 2900bcea1deb7bc8479a84a23d758efdfdd2b2d3' Mar 09 20:00:49 localhost kernel: clk: Disabling unused clocks Mar 09 20:00:49 localhost kernel: Freeing unused decrypted memory: 2028K Mar 09 20:00:49 localhost kernel: Freeing unused kernel image (initmem) memory: 4204K Mar 09 20:00:49 localhost kernel: Write protecting the kernel read-only data: 30720k Mar 09 20:00:49 localhost kernel: Freeing unused kernel image (rodata/data gap) memory: 380K Mar 09 20:00:49 localhost kernel: x86/mm: Checked W+X mappings: passed, no W+X pages found. Mar 09 20:00:49 localhost kernel: Run /init as init process Mar 09 20:00:49 localhost kernel: with arguments: Mar 09 20:00:49 localhost kernel: /init Mar 09 20:00:49 localhost kernel: with environment: Mar 09 20:00:49 localhost kernel: HOME=/ Mar 09 20:00:49 localhost kernel: TERM=linux Mar 09 20:00:49 localhost kernel: BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-687.el9.x86_64 Mar 09 20:00:49 localhost systemd[1]: systemd 252-67.el9 running in system mode (+PAM +AUDIT +SELINUX -APPARMOR +IMA +SMACK +SECCOMP +GCRYPT +GNUTLS +OPENSSL +ACL +BLKID +CURL +ELFUTILS +FIDO2 +IDN2 -IDN -IPTC +KMOD +LIBCRYPTSETUP +LIBFDISK +PCRE2 -PWQUALITY +P11KIT -QRENCODE +TPM2 +BZIP2 +LZ4 +XZ +ZLIB +ZSTD -BPF_FRAMEWORK +XKBCOMMON +UTMP +SYSVINIT default-hierarchy=unified) Mar 09 20:00:49 localhost systemd[1]: Detected virtualization kvm. Mar 09 20:00:49 localhost systemd[1]: Detected architecture x86-64. Mar 09 20:00:49 localhost systemd[1]: Running in initrd. Mar 09 20:00:49 localhost systemd[1]: No hostname configured, using default hostname. Mar 09 20:00:49 localhost systemd[1]: Hostname set to . Mar 09 20:00:49 localhost systemd[1]: Initializing machine ID from VM UUID. Mar 09 20:00:49 localhost kernel: usb 1-1: New USB device found, idVendor=0627, idProduct=0001, bcdDevice= 0.00 Mar 09 20:00:49 localhost kernel: usb 1-1: New USB device strings: Mfr=1, Product=3, SerialNumber=10 Mar 09 20:00:49 localhost kernel: usb 1-1: Product: QEMU USB Tablet Mar 09 20:00:49 localhost kernel: usb 1-1: Manufacturer: QEMU Mar 09 20:00:49 localhost kernel: usb 1-1: SerialNumber: 28754-0000:00:01.2-1 Mar 09 20:00:49 localhost kernel: input: QEMU QEMU USB Tablet as /devices/pci0000:00/0000:00:01.2/usb1/1-1/1-1:1.0/0003:0627:0001.0001/input/input5 Mar 09 20:00:49 localhost kernel: hid-generic 0003:0627:0001.0001: input,hidraw0: USB HID v0.01 Mouse [QEMU QEMU USB Tablet] on usb-0000:00:01.2-1/input0 Mar 09 20:00:49 localhost systemd[1]: Queued start job for default target Initrd Default Target. Mar 09 20:00:49 localhost systemd[1]: Started Dispatch Password Requests to Console Directory Watch. Mar 09 20:00:49 localhost systemd[1]: Reached target Local Encrypted Volumes. Mar 09 20:00:49 localhost systemd[1]: Reached target Initrd /usr File System. Mar 09 20:00:49 localhost systemd[1]: Reached target Local File Systems. Mar 09 20:00:49 localhost systemd[1]: Reached target Path Units. Mar 09 20:00:49 localhost systemd[1]: Reached target Slice Units. Mar 09 20:00:49 localhost systemd[1]: Reached target Swaps. Mar 09 20:00:49 localhost systemd[1]: Reached target Timer Units. Mar 09 20:00:49 localhost systemd[1]: Listening on D-Bus System Message Bus Socket. Mar 09 20:00:49 localhost systemd[1]: Listening on Journal Socket (/dev/log). Mar 09 20:00:49 localhost systemd[1]: Listening on Journal Socket. Mar 09 20:00:49 localhost systemd[1]: Listening on udev Control Socket. Mar 09 20:00:49 localhost systemd[1]: Listening on udev Kernel Socket. Mar 09 20:00:49 localhost systemd[1]: Reached target Socket Units. Mar 09 20:00:49 localhost systemd[1]: Starting Create List of Static Device Nodes... Mar 09 20:00:49 localhost systemd[1]: Starting Journal Service... Mar 09 20:00:49 localhost systemd[1]: Load Kernel Modules was skipped because no trigger condition checks were met. Mar 09 20:00:49 localhost systemd[1]: Starting Apply Kernel Variables... Mar 09 20:00:49 localhost systemd[1]: Starting Create System Users... Mar 09 20:00:49 localhost systemd[1]: Starting Setup Virtual Console... Mar 09 20:00:49 localhost systemd[1]: Finished Create List of Static Device Nodes. Mar 09 20:00:49 localhost systemd[1]: Finished Apply Kernel Variables. Mar 09 20:00:49 localhost systemd[1]: Finished Create System Users. Mar 09 20:00:49 localhost systemd-journald[309]: Journal started Mar 09 20:00:49 localhost systemd-journald[309]: Runtime Journal (/run/log/journal/b0da24b47bdb4be78268d42542a6e0a5) is 8.0M, max 153.6M, 145.6M free. Mar 09 20:00:49 localhost systemd-sysusers[313]: Creating group 'users' with GID 100. Mar 09 20:00:49 localhost systemd-sysusers[313]: Creating group 'dbus' with GID 81. Mar 09 20:00:49 localhost systemd-sysusers[313]: Creating user 'dbus' (System Message Bus) with UID 81 and GID 81. Mar 09 20:00:49 localhost systemd[1]: Started Journal Service. Mar 09 20:00:49 localhost systemd[1]: Starting Create Static Device Nodes in /dev... Mar 09 20:00:49 localhost systemd[1]: Starting Create Volatile Files and Directories... Mar 09 20:00:49 localhost systemd[1]: Finished Create Static Device Nodes in /dev. Mar 09 20:00:49 localhost systemd[1]: Finished Create Volatile Files and Directories. Mar 09 20:00:49 localhost systemd[1]: Finished Setup Virtual Console. Mar 09 20:00:49 localhost systemd[1]: dracut ask for additional cmdline parameters was skipped because no trigger condition checks were met. Mar 09 20:00:49 localhost systemd[1]: Starting dracut cmdline hook... Mar 09 20:00:49 localhost dracut-cmdline[328]: dracut-9 dracut-057-110.git20260130.el9 Mar 09 20:00:49 localhost dracut-cmdline[328]: Using kernel command line parameters: BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-687.el9.x86_64 root=UUID=d70e3b08-39eb-4644-ba12-579a10c34a4e ro console=ttyS0,115200n8 no_timer_check net.ifnames=0 crashkernel=1G-2G:192M,2G-64G:256M,64G-:512M Mar 09 20:00:49 localhost systemd[1]: Finished dracut cmdline hook. Mar 09 20:00:49 localhost systemd[1]: Starting dracut pre-udev hook... Mar 09 20:00:49 localhost kernel: device-mapper: core: CONFIG_IMA_DISABLE_HTABLE is disabled. Duplicate IMA measurements will not be recorded in the IMA log. Mar 09 20:00:49 localhost kernel: device-mapper: uevent: version 1.0.3 Mar 09 20:00:49 localhost kernel: device-mapper: ioctl: 4.50.0-ioctl (2025-04-28) initialised: dm-devel@lists.linux.dev Mar 09 20:00:49 localhost kernel: RPC: Registered named UNIX socket transport module. Mar 09 20:00:49 localhost kernel: RPC: Registered udp transport module. Mar 09 20:00:49 localhost kernel: RPC: Registered tcp transport module. Mar 09 20:00:49 localhost kernel: RPC: Registered tcp-with-tls transport module. Mar 09 20:00:49 localhost kernel: RPC: Registered tcp NFSv4.1 backchannel transport module. Mar 09 20:00:49 localhost rpc.statd[445]: Version 2.5.4 starting Mar 09 20:00:49 localhost rpc.statd[445]: Initializing NSM state Mar 09 20:00:49 localhost rpc.idmapd[450]: Setting log level to 0 Mar 09 20:00:49 localhost systemd[1]: Finished dracut pre-udev hook. Mar 09 20:00:49 localhost systemd[1]: Starting Rule-based Manager for Device Events and Files... Mar 09 20:00:49 localhost systemd-udevd[463]: Using default interface naming scheme 'rhel-9.0'. Mar 09 20:00:49 localhost systemd[1]: Started Rule-based Manager for Device Events and Files. Mar 09 20:00:49 localhost systemd[1]: Starting dracut pre-trigger hook... Mar 09 20:00:49 localhost systemd[1]: Finished dracut pre-trigger hook. Mar 09 20:00:49 localhost systemd[1]: Starting Coldplug All udev Devices... Mar 09 20:00:49 localhost systemd[1]: Created slice Slice /system/modprobe. Mar 09 20:00:49 localhost systemd[1]: Starting Load Kernel Module configfs... Mar 09 20:00:49 localhost systemd[1]: Finished Coldplug All udev Devices. Mar 09 20:00:49 localhost systemd[1]: modprobe@configfs.service: Deactivated successfully. Mar 09 20:00:49 localhost systemd[1]: Finished Load Kernel Module configfs. Mar 09 20:00:49 localhost systemd[1]: nm-initrd.service was skipped because of an unmet condition check (ConditionPathExists=/run/NetworkManager/initrd/neednet). Mar 09 20:00:49 localhost systemd[1]: Reached target Network. Mar 09 20:00:49 localhost systemd[1]: nm-wait-online-initrd.service was skipped because of an unmet condition check (ConditionPathExists=/run/NetworkManager/initrd/neednet). Mar 09 20:00:49 localhost systemd[1]: Starting dracut initqueue hook... Mar 09 20:00:49 localhost kernel: libata version 3.00 loaded. Mar 09 20:00:50 localhost kernel: ata_piix 0000:00:01.1: version 2.13 Mar 09 20:00:50 localhost kernel: scsi host0: ata_piix Mar 09 20:00:50 localhost kernel: scsi host1: ata_piix Mar 09 20:00:50 localhost kernel: ata1: PATA max MWDMA2 cmd 0x1f0 ctl 0x3f6 bmdma 0xc140 irq 14 lpm-pol 0 Mar 09 20:00:50 localhost kernel: ata2: PATA max MWDMA2 cmd 0x170 ctl 0x376 bmdma 0xc148 irq 15 lpm-pol 0 Mar 09 20:00:50 localhost kernel: virtio_blk virtio2: 8/0/0 default/read/poll queues Mar 09 20:00:50 localhost systemd[1]: Mounting Kernel Configuration File System... Mar 09 20:00:50 localhost systemd-udevd[475]: Network interface NamePolicy= disabled on kernel command line. Mar 09 20:00:50 localhost systemd[1]: Mounted Kernel Configuration File System. Mar 09 20:00:50 localhost kernel: virtio_blk virtio2: [vda] 83886080 512-byte logical blocks (42.9 GB/40.0 GiB) Mar 09 20:00:50 localhost kernel: vda: vda1 Mar 09 20:00:50 localhost systemd[1]: Reached target System Initialization. Mar 09 20:00:50 localhost systemd[1]: Reached target Basic System. Mar 09 20:00:50 localhost kernel: ACPI: bus type drm_connector registered Mar 09 20:00:50 localhost kernel: ata1: found unknown device (class 0) Mar 09 20:00:50 localhost kernel: ata1.00: ATAPI: QEMU DVD-ROM, 2.5+, max UDMA/100 Mar 09 20:00:50 localhost kernel: scsi 0:0:0:0: CD-ROM QEMU QEMU DVD-ROM 2.5+ PQ: 0 ANSI: 5 Mar 09 20:00:50 localhost kernel: scsi 0:0:0:0: Attached scsi generic sg0 type 5 Mar 09 20:00:50 localhost kernel: sr 0:0:0:0: [sr0] scsi3-mmc drive: 4x/4x cd/rw xa/form2 tray Mar 09 20:00:50 localhost kernel: cdrom: Uniform CD-ROM driver Revision: 3.20 Mar 09 20:00:50 localhost systemd[1]: Found device /dev/disk/by-uuid/d70e3b08-39eb-4644-ba12-579a10c34a4e. Mar 09 20:00:50 localhost kernel: [drm] pci: virtio-vga detected at 0000:00:02.0 Mar 09 20:00:50 localhost kernel: virtio-pci 0000:00:02.0: vgaarb: deactivate vga console Mar 09 20:00:50 localhost kernel: sr 0:0:0:0: Attached scsi CD-ROM sr0 Mar 09 20:00:50 localhost kernel: Console: switching to colour dummy device 80x25 Mar 09 20:00:50 localhost systemd[1]: Reached target Initrd Root Device. Mar 09 20:00:50 localhost kernel: [drm] features: -virgl +edid -resource_blob -host_visible Mar 09 20:00:50 localhost kernel: [drm] features: -context_init Mar 09 20:00:50 localhost kernel: [drm] number of scanouts: 1 Mar 09 20:00:50 localhost kernel: [drm] number of cap sets: 0 Mar 09 20:00:50 localhost kernel: [drm] Initialized virtio_gpu 0.1.0 for 0000:00:02.0 on minor 0 Mar 09 20:00:50 localhost kernel: fbcon: virtio_gpudrmfb (fb0) is primary device Mar 09 20:00:50 localhost kernel: Console: switching to colour frame buffer device 128x48 Mar 09 20:00:50 localhost kernel: virtio-pci 0000:00:02.0: [drm] fb0: virtio_gpudrmfb frame buffer device Mar 09 20:00:50 localhost systemd[1]: Finished dracut initqueue hook. Mar 09 20:00:50 localhost systemd[1]: Reached target Preparation for Remote File Systems. Mar 09 20:00:50 localhost systemd[1]: Reached target Remote Encrypted Volumes. Mar 09 20:00:50 localhost systemd[1]: Reached target Remote File Systems. Mar 09 20:00:50 localhost systemd[1]: Starting dracut pre-mount hook... Mar 09 20:00:50 localhost systemd[1]: Finished dracut pre-mount hook. Mar 09 20:00:50 localhost systemd[1]: Starting File System Check on /dev/disk/by-uuid/d70e3b08-39eb-4644-ba12-579a10c34a4e... Mar 09 20:00:50 localhost systemd-fsck[570]: /usr/sbin/fsck.xfs: XFS file system. Mar 09 20:00:50 localhost systemd[1]: Finished File System Check on /dev/disk/by-uuid/d70e3b08-39eb-4644-ba12-579a10c34a4e. Mar 09 20:00:50 localhost systemd[1]: Mounting /sysroot... Mar 09 20:00:50 localhost kernel: SGI XFS with ACLs, security attributes, scrub, quota, no debug enabled Mar 09 20:00:50 localhost kernel: XFS (vda1): Mounting V5 Filesystem d70e3b08-39eb-4644-ba12-579a10c34a4e Mar 09 20:00:51 localhost kernel: XFS (vda1): Ending clean mount Mar 09 20:00:51 localhost systemd[1]: Mounted /sysroot. Mar 09 20:00:51 localhost systemd[1]: Reached target Initrd Root File System. Mar 09 20:00:51 localhost systemd[1]: Starting Mountpoints Configured in the Real Root... Mar 09 20:00:51 localhost systemd[1]: initrd-parse-etc.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Finished Mountpoints Configured in the Real Root. Mar 09 20:00:51 localhost systemd[1]: Reached target Initrd File Systems. Mar 09 20:00:51 localhost systemd[1]: Reached target Initrd Default Target. Mar 09 20:00:51 localhost systemd[1]: Starting dracut mount hook... Mar 09 20:00:51 localhost systemd[1]: Finished dracut mount hook. Mar 09 20:00:51 localhost systemd[1]: Starting dracut pre-pivot and cleanup hook... Mar 09 20:00:51 localhost rpc.idmapd[450]: exiting on signal 15 Mar 09 20:00:51 localhost systemd[1]: var-lib-nfs-rpc_pipefs.mount: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Finished dracut pre-pivot and cleanup hook. Mar 09 20:00:51 localhost systemd[1]: Starting Cleaning Up and Shutting Down Daemons... Mar 09 20:00:51 localhost systemd[1]: Stopped target Network. Mar 09 20:00:51 localhost systemd[1]: Stopped target Remote Encrypted Volumes. Mar 09 20:00:51 localhost systemd[1]: Stopped target Timer Units. Mar 09 20:00:51 localhost systemd[1]: dbus.socket: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Closed D-Bus System Message Bus Socket. Mar 09 20:00:51 localhost systemd[1]: dracut-pre-pivot.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped dracut pre-pivot and cleanup hook. Mar 09 20:00:51 localhost systemd[1]: Stopped target Initrd Default Target. Mar 09 20:00:51 localhost systemd[1]: Stopped target Basic System. Mar 09 20:00:51 localhost systemd[1]: Stopped target Initrd Root Device. Mar 09 20:00:51 localhost systemd[1]: Stopped target Initrd /usr File System. Mar 09 20:00:51 localhost systemd[1]: Stopped target Path Units. Mar 09 20:00:51 localhost systemd[1]: Stopped target Remote File Systems. Mar 09 20:00:51 localhost systemd[1]: Stopped target Preparation for Remote File Systems. Mar 09 20:00:51 localhost systemd[1]: Stopped target Slice Units. Mar 09 20:00:51 localhost systemd[1]: Stopped target Socket Units. Mar 09 20:00:51 localhost systemd[1]: Stopped target System Initialization. Mar 09 20:00:51 localhost systemd[1]: Stopped target Local File Systems. Mar 09 20:00:51 localhost systemd[1]: Stopped target Swaps. Mar 09 20:00:51 localhost systemd[1]: dracut-mount.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped dracut mount hook. Mar 09 20:00:51 localhost systemd[1]: dracut-pre-mount.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped dracut pre-mount hook. Mar 09 20:00:51 localhost systemd[1]: Stopped target Local Encrypted Volumes. Mar 09 20:00:51 localhost systemd[1]: systemd-ask-password-console.path: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped Dispatch Password Requests to Console Directory Watch. Mar 09 20:00:51 localhost systemd[1]: dracut-initqueue.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped dracut initqueue hook. Mar 09 20:00:51 localhost systemd[1]: systemd-sysctl.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped Apply Kernel Variables. Mar 09 20:00:51 localhost systemd[1]: systemd-tmpfiles-setup.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped Create Volatile Files and Directories. Mar 09 20:00:51 localhost systemd[1]: systemd-udev-trigger.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped Coldplug All udev Devices. Mar 09 20:00:51 localhost systemd[1]: dracut-pre-trigger.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped dracut pre-trigger hook. Mar 09 20:00:51 localhost systemd[1]: Stopping Rule-based Manager for Device Events and Files... Mar 09 20:00:51 localhost systemd[1]: systemd-vconsole-setup.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped Setup Virtual Console. Mar 09 20:00:51 localhost systemd[1]: run-credentials-systemd\x2dtmpfiles\x2dsetup.service.mount: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: run-credentials-systemd\x2dsysctl.service.mount: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: systemd-udevd.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped Rule-based Manager for Device Events and Files. Mar 09 20:00:51 localhost systemd[1]: systemd-udevd.service: Consumed 1.353s CPU time. Mar 09 20:00:51 localhost systemd[1]: systemd-udevd-control.socket: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Closed udev Control Socket. Mar 09 20:00:51 localhost systemd[1]: systemd-udevd-kernel.socket: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Closed udev Kernel Socket. Mar 09 20:00:51 localhost systemd[1]: dracut-pre-udev.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped dracut pre-udev hook. Mar 09 20:00:51 localhost systemd[1]: dracut-cmdline.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped dracut cmdline hook. Mar 09 20:00:51 localhost systemd[1]: Starting Cleanup udev Database... Mar 09 20:00:51 localhost systemd[1]: systemd-tmpfiles-setup-dev.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped Create Static Device Nodes in /dev. Mar 09 20:00:51 localhost systemd[1]: kmod-static-nodes.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped Create List of Static Device Nodes. Mar 09 20:00:51 localhost systemd[1]: systemd-sysusers.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Stopped Create System Users. Mar 09 20:00:51 localhost systemd[1]: run-credentials-systemd\x2dtmpfiles\x2dsetup\x2ddev.service.mount: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: run-credentials-systemd\x2dsysusers.service.mount: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: initrd-cleanup.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Finished Cleaning Up and Shutting Down Daemons. Mar 09 20:00:51 localhost systemd[1]: initrd-udevadm-cleanup-db.service: Deactivated successfully. Mar 09 20:00:51 localhost systemd[1]: Finished Cleanup udev Database. Mar 09 20:00:51 localhost systemd[1]: Reached target Switch Root. Mar 09 20:00:51 localhost systemd[1]: Starting Switch Root... Mar 09 20:00:51 localhost systemd[1]: Switching root. Mar 09 20:00:51 localhost systemd-journald[309]: Journal stopped Mar 09 20:00:52 localhost systemd-journald[309]: Received SIGTERM from PID 1 (systemd). Mar 09 20:00:52 localhost kernel: audit: type=1404 audit(1773100851.570:2): enforcing=1 old_enforcing=0 auid=4294967295 ses=4294967295 enabled=1 old-enabled=1 lsm=selinux res=1 Mar 09 20:00:52 localhost kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:00:52 localhost kernel: SELinux: policy capability open_perms=1 Mar 09 20:00:52 localhost kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:00:52 localhost kernel: SELinux: policy capability always_check_network=0 Mar 09 20:00:52 localhost kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:00:52 localhost kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:00:52 localhost kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:00:52 localhost kernel: audit: type=1403 audit(1773100851.707:3): auid=4294967295 ses=4294967295 lsm=selinux res=1 Mar 09 20:00:52 localhost systemd[1]: Successfully loaded SELinux policy in 143.498ms. Mar 09 20:00:52 localhost systemd[1]: Relabelled /dev, /dev/shm, /run, /sys/fs/cgroup in 42.277ms. Mar 09 20:00:52 localhost systemd[1]: systemd 252-67.el9 running in system mode (+PAM +AUDIT +SELINUX -APPARMOR +IMA +SMACK +SECCOMP +GCRYPT +GNUTLS +OPENSSL +ACL +BLKID +CURL +ELFUTILS +FIDO2 +IDN2 -IDN -IPTC +KMOD +LIBCRYPTSETUP +LIBFDISK +PCRE2 -PWQUALITY +P11KIT -QRENCODE +TPM2 +BZIP2 +LZ4 +XZ +ZLIB +ZSTD -BPF_FRAMEWORK +XKBCOMMON +UTMP +SYSVINIT default-hierarchy=unified) Mar 09 20:00:52 localhost systemd[1]: Detected virtualization kvm. Mar 09 20:00:52 localhost systemd[1]: Detected architecture x86-64. Mar 09 20:00:52 localhost systemd-rc-local-generator[653]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:00:52 localhost systemd[1]: initrd-switch-root.service: Deactivated successfully. Mar 09 20:00:52 localhost systemd[1]: Stopped Switch Root. Mar 09 20:00:52 localhost systemd[1]: systemd-journald.service: Scheduled restart job, restart counter is at 1. Mar 09 20:00:52 localhost systemd[1]: Created slice Slice /system/getty. Mar 09 20:00:52 localhost systemd[1]: Created slice Slice /system/serial-getty. Mar 09 20:00:52 localhost systemd[1]: Created slice Slice /system/sshd-keygen. Mar 09 20:00:52 localhost systemd[1]: Created slice User and Session Slice. Mar 09 20:00:52 localhost systemd[1]: Started Dispatch Password Requests to Console Directory Watch. Mar 09 20:00:52 localhost systemd[1]: Started Forward Password Requests to Wall Directory Watch. Mar 09 20:00:52 localhost systemd[1]: Set up automount Arbitrary Executable File Formats File System Automount Point. Mar 09 20:00:52 localhost systemd[1]: Reached target Local Encrypted Volumes. Mar 09 20:00:52 localhost systemd[1]: Stopped target Switch Root. Mar 09 20:00:52 localhost systemd[1]: Stopped target Initrd File Systems. Mar 09 20:00:52 localhost systemd[1]: Stopped target Initrd Root File System. Mar 09 20:00:52 localhost systemd[1]: Reached target Local Integrity Protected Volumes. Mar 09 20:00:52 localhost systemd[1]: Reached target Path Units. Mar 09 20:00:52 localhost systemd[1]: Reached target rpc_pipefs.target. Mar 09 20:00:52 localhost systemd[1]: Reached target Slice Units. Mar 09 20:00:52 localhost systemd[1]: Reached target Swaps. Mar 09 20:00:52 localhost systemd[1]: Reached target Local Verity Protected Volumes. Mar 09 20:00:52 localhost systemd[1]: Listening on RPCbind Server Activation Socket. Mar 09 20:00:52 localhost systemd[1]: Reached target RPC Port Mapper. Mar 09 20:00:52 localhost systemd[1]: Listening on Process Core Dump Socket. Mar 09 20:00:52 localhost systemd[1]: Listening on initctl Compatibility Named Pipe. Mar 09 20:00:52 localhost systemd[1]: Listening on udev Control Socket. Mar 09 20:00:52 localhost systemd[1]: Listening on udev Kernel Socket. Mar 09 20:00:52 localhost systemd[1]: Mounting Huge Pages File System... Mar 09 20:00:52 localhost systemd[1]: Mounting POSIX Message Queue File System... Mar 09 20:00:52 localhost systemd[1]: Mounting Kernel Debug File System... Mar 09 20:00:52 localhost systemd[1]: Mounting Kernel Trace File System... Mar 09 20:00:52 localhost systemd[1]: Kernel Module supporting RPCSEC_GSS was skipped because of an unmet condition check (ConditionPathExists=/etc/krb5.keytab). Mar 09 20:00:52 localhost systemd[1]: Starting Create List of Static Device Nodes... Mar 09 20:00:52 localhost systemd[1]: Starting Load Kernel Module configfs... Mar 09 20:00:52 localhost systemd[1]: Starting Load Kernel Module drm... Mar 09 20:00:52 localhost systemd[1]: Starting Load Kernel Module efi_pstore... Mar 09 20:00:52 localhost systemd[1]: Starting Load Kernel Module fuse... Mar 09 20:00:52 localhost systemd[1]: Starting Read and set NIS domainname from /etc/sysconfig/network... Mar 09 20:00:52 localhost systemd[1]: systemd-fsck-root.service: Deactivated successfully. Mar 09 20:00:52 localhost systemd[1]: Stopped File System Check on Root Device. Mar 09 20:00:52 localhost systemd[1]: Stopped Journal Service. Mar 09 20:00:52 localhost systemd[1]: Starting Journal Service... Mar 09 20:00:52 localhost systemd[1]: Load Kernel Modules was skipped because no trigger condition checks were met. Mar 09 20:00:52 localhost systemd[1]: Starting Generate network units from Kernel command line... Mar 09 20:00:52 localhost systemd[1]: TPM2 PCR Machine ID Measurement was skipped because of an unmet condition check (ConditionPathExists=/sys/firmware/efi/efivars/StubPcrKernelImage-4a67b082-0a4c-41cf-b6c7-440b29bb8c4f). Mar 09 20:00:52 localhost systemd[1]: Starting Remount Root and Kernel File Systems... Mar 09 20:00:52 localhost systemd[1]: Repartition Root Disk was skipped because no trigger condition checks were met. Mar 09 20:00:52 localhost systemd[1]: Starting Apply Kernel Variables... Mar 09 20:00:52 localhost systemd[1]: Starting Coldplug All udev Devices... Mar 09 20:00:52 localhost kernel: xfs filesystem being remounted at / supports timestamps until 2038 (0x7fffffff) Mar 09 20:00:52 localhost systemd-journald[701]: Journal started Mar 09 20:00:52 localhost systemd-journald[701]: Runtime Journal (/run/log/journal/a041fb9630bca3daad34a05814b4da25) is 8.0M, max 153.6M, 145.6M free. Mar 09 20:00:52 localhost systemd[1]: Queued start job for default target Multi-User System. Mar 09 20:00:52 localhost systemd[1]: systemd-journald.service: Deactivated successfully. Mar 09 20:00:52 localhost kernel: fuse: init (API version 7.37) Mar 09 20:00:52 localhost systemd[1]: Started Journal Service. Mar 09 20:00:52 localhost systemd[1]: Mounted Huge Pages File System. Mar 09 20:00:52 localhost systemd[1]: Mounted POSIX Message Queue File System. Mar 09 20:00:52 localhost systemd[1]: Mounted Kernel Debug File System. Mar 09 20:00:52 localhost systemd[1]: Mounted Kernel Trace File System. Mar 09 20:00:52 localhost systemd[1]: Finished Create List of Static Device Nodes. Mar 09 20:00:52 localhost systemd[1]: modprobe@configfs.service: Deactivated successfully. Mar 09 20:00:52 localhost systemd[1]: Finished Load Kernel Module configfs. Mar 09 20:00:52 localhost systemd[1]: modprobe@drm.service: Deactivated successfully. Mar 09 20:00:52 localhost systemd[1]: Finished Load Kernel Module drm. Mar 09 20:00:52 localhost systemd[1]: modprobe@efi_pstore.service: Deactivated successfully. Mar 09 20:00:52 localhost systemd[1]: Finished Load Kernel Module efi_pstore. Mar 09 20:00:52 localhost systemd[1]: modprobe@fuse.service: Deactivated successfully. Mar 09 20:00:52 localhost systemd[1]: Finished Load Kernel Module fuse. Mar 09 20:00:52 localhost systemd[1]: Finished Read and set NIS domainname from /etc/sysconfig/network. Mar 09 20:00:52 localhost systemd[1]: Finished Generate network units from Kernel command line. Mar 09 20:00:52 localhost systemd[1]: Finished Remount Root and Kernel File Systems. Mar 09 20:00:52 localhost systemd[1]: Finished Apply Kernel Variables. Mar 09 20:00:52 localhost systemd[1]: Mounting FUSE Control File System... Mar 09 20:00:52 localhost systemd[1]: First Boot Wizard was skipped because of an unmet condition check (ConditionFirstBoot=yes). Mar 09 20:00:52 localhost systemd[1]: Starting Rebuild Hardware Database... Mar 09 20:00:52 localhost systemd[1]: Starting Flush Journal to Persistent Storage... Mar 09 20:00:52 localhost systemd[1]: Platform Persistent Storage Archival was skipped because of an unmet condition check (ConditionDirectoryNotEmpty=/sys/fs/pstore). Mar 09 20:00:52 localhost systemd[1]: Starting Load/Save OS Random Seed... Mar 09 20:00:52 localhost systemd[1]: Starting Create System Users... Mar 09 20:00:52 localhost systemd-journald[701]: Runtime Journal (/run/log/journal/a041fb9630bca3daad34a05814b4da25) is 8.0M, max 153.6M, 145.6M free. Mar 09 20:00:52 localhost systemd-journald[701]: Received client request to flush runtime journal. Mar 09 20:00:52 localhost systemd[1]: Finished Coldplug All udev Devices. Mar 09 20:00:52 localhost systemd[1]: Mounted FUSE Control File System. Mar 09 20:00:52 localhost systemd[1]: Finished Flush Journal to Persistent Storage. Mar 09 20:00:52 localhost systemd[1]: Finished Load/Save OS Random Seed. Mar 09 20:00:52 localhost systemd[1]: First Boot Complete was skipped because of an unmet condition check (ConditionFirstBoot=yes). Mar 09 20:00:52 localhost systemd[1]: Finished Create System Users. Mar 09 20:00:52 localhost systemd[1]: Starting Create Static Device Nodes in /dev... Mar 09 20:00:52 localhost systemd[1]: Finished Create Static Device Nodes in /dev. Mar 09 20:00:52 localhost systemd[1]: Reached target Preparation for Local File Systems. Mar 09 20:00:52 localhost systemd[1]: Reached target Local File Systems. Mar 09 20:00:52 localhost systemd[1]: Starting Rebuild Dynamic Linker Cache... Mar 09 20:00:52 localhost systemd[1]: Mark the need to relabel after reboot was skipped because of an unmet condition check (ConditionSecurity=!selinux). Mar 09 20:00:52 localhost systemd[1]: Set Up Additional Binary Formats was skipped because no trigger condition checks were met. Mar 09 20:00:52 localhost systemd[1]: Update Boot Loader Random Seed was skipped because no trigger condition checks were met. Mar 09 20:00:52 localhost systemd[1]: Starting Automatic Boot Loader Update... Mar 09 20:00:52 localhost systemd[1]: Commit a transient machine-id on disk was skipped because of an unmet condition check (ConditionPathIsMountPoint=/etc/machine-id). Mar 09 20:00:52 localhost systemd[1]: Starting Create Volatile Files and Directories... Mar 09 20:00:52 localhost bootctl[720]: Couldn't find EFI system partition, skipping. Mar 09 20:00:52 localhost systemd[1]: Finished Automatic Boot Loader Update. Mar 09 20:00:52 localhost systemd[1]: Finished Create Volatile Files and Directories. Mar 09 20:00:52 localhost systemd[1]: Starting Security Auditing Service... Mar 09 20:00:52 localhost systemd[1]: Starting RPC Bind... Mar 09 20:00:52 localhost systemd[1]: Starting Rebuild Journal Catalog... Mar 09 20:00:52 localhost auditd[726]: audit dispatcher initialized with q_depth=2000 and 1 active plugins Mar 09 20:00:52 localhost auditd[726]: Init complete, auditd 3.1.5 listening for events (startup state enable) Mar 09 20:00:52 localhost systemd[1]: Finished Rebuild Journal Catalog. Mar 09 20:00:52 localhost augenrules[731]: /sbin/augenrules: No change Mar 09 20:00:52 localhost systemd[1]: Started RPC Bind. Mar 09 20:00:52 localhost augenrules[746]: No rules Mar 09 20:00:52 localhost augenrules[746]: enabled 1 Mar 09 20:00:52 localhost augenrules[746]: failure 1 Mar 09 20:00:52 localhost augenrules[746]: pid 726 Mar 09 20:00:52 localhost augenrules[746]: rate_limit 0 Mar 09 20:00:52 localhost augenrules[746]: backlog_limit 8192 Mar 09 20:00:52 localhost augenrules[746]: lost 0 Mar 09 20:00:52 localhost augenrules[746]: backlog 4 Mar 09 20:00:52 localhost augenrules[746]: backlog_wait_time 60000 Mar 09 20:00:52 localhost augenrules[746]: backlog_wait_time_actual 0 Mar 09 20:00:52 localhost augenrules[746]: enabled 1 Mar 09 20:00:52 localhost augenrules[746]: failure 1 Mar 09 20:00:52 localhost augenrules[746]: pid 726 Mar 09 20:00:52 localhost augenrules[746]: rate_limit 0 Mar 09 20:00:52 localhost augenrules[746]: backlog_limit 8192 Mar 09 20:00:52 localhost augenrules[746]: lost 0 Mar 09 20:00:52 localhost augenrules[746]: backlog 5 Mar 09 20:00:52 localhost augenrules[746]: backlog_wait_time 60000 Mar 09 20:00:52 localhost augenrules[746]: backlog_wait_time_actual 0 Mar 09 20:00:52 localhost augenrules[746]: enabled 1 Mar 09 20:00:52 localhost augenrules[746]: failure 1 Mar 09 20:00:52 localhost augenrules[746]: pid 726 Mar 09 20:00:52 localhost augenrules[746]: rate_limit 0 Mar 09 20:00:52 localhost augenrules[746]: backlog_limit 8192 Mar 09 20:00:52 localhost augenrules[746]: lost 0 Mar 09 20:00:52 localhost augenrules[746]: backlog 8 Mar 09 20:00:52 localhost augenrules[746]: backlog_wait_time 60000 Mar 09 20:00:52 localhost augenrules[746]: backlog_wait_time_actual 0 Mar 09 20:00:52 localhost systemd[1]: Started Security Auditing Service. Mar 09 20:00:52 localhost systemd[1]: Starting Record System Boot/Shutdown in UTMP... Mar 09 20:00:52 localhost systemd[1]: Finished Record System Boot/Shutdown in UTMP. Mar 09 20:00:52 localhost systemd[1]: Finished Rebuild Dynamic Linker Cache. Mar 09 20:00:53 localhost systemd[1]: Finished Rebuild Hardware Database. Mar 09 20:00:53 localhost systemd[1]: Starting Rule-based Manager for Device Events and Files... Mar 09 20:00:53 localhost systemd[1]: Starting Update is Completed... Mar 09 20:00:53 localhost systemd[1]: Finished Update is Completed. Mar 09 20:00:53 localhost systemd-udevd[754]: Using default interface naming scheme 'rhel-9.0'. Mar 09 20:00:53 localhost systemd[1]: Started Rule-based Manager for Device Events and Files. Mar 09 20:00:53 localhost systemd[1]: Reached target System Initialization. Mar 09 20:00:53 localhost systemd[1]: Started dnf makecache --timer. Mar 09 20:00:53 localhost systemd[1]: Started Daily rotation of log files. Mar 09 20:00:53 localhost systemd[1]: Started Daily Cleanup of Temporary Directories. Mar 09 20:00:53 localhost systemd[1]: Reached target Timer Units. Mar 09 20:00:53 localhost systemd[1]: Listening on D-Bus System Message Bus Socket. Mar 09 20:00:53 localhost systemd[1]: Listening on SSSD Kerberos Cache Manager responder socket. Mar 09 20:00:53 localhost systemd[1]: Reached target Socket Units. Mar 09 20:00:53 localhost systemd[1]: Starting D-Bus System Message Bus... Mar 09 20:00:53 localhost systemd[1]: TPM2 PCR Barrier (Initialization) was skipped because of an unmet condition check (ConditionPathExists=/sys/firmware/efi/efivars/StubPcrKernelImage-4a67b082-0a4c-41cf-b6c7-440b29bb8c4f). Mar 09 20:00:53 localhost systemd[1]: Condition check resulted in /dev/ttyS0 being skipped. Mar 09 20:00:53 localhost systemd[1]: Starting Load Kernel Module configfs... Mar 09 20:00:53 localhost systemd-udevd[767]: Network interface NamePolicy= disabled on kernel command line. Mar 09 20:00:53 localhost systemd[1]: modprobe@configfs.service: Deactivated successfully. Mar 09 20:00:53 localhost systemd[1]: Finished Load Kernel Module configfs. Mar 09 20:00:53 localhost systemd[1]: Started D-Bus System Message Bus. Mar 09 20:00:53 localhost systemd[1]: Reached target Basic System. Mar 09 20:00:53 localhost dbus-broker-lau[789]: Ready Mar 09 20:00:53 localhost systemd[1]: Starting NTP client/server... Mar 09 20:00:53 localhost kernel: input: PC Speaker as /devices/platform/pcspkr/input/input6 Mar 09 20:00:53 localhost chronyd[816]: chronyd version 4.8 starting (+CMDMON +REFCLOCK +RTC +PRIVDROP +SCFILTER +SIGND +NTS +SECHASH +IPV6 +DEBUG) Mar 09 20:00:53 localhost chronyd[816]: Loaded 0 symmetric keys Mar 09 20:00:53 localhost chronyd[816]: Using right/UTC timezone to obtain leap second data Mar 09 20:00:53 localhost chronyd[816]: Loaded seccomp filter (level 2) Mar 09 20:00:53 localhost kernel: piix4_smbus 0000:00:01.3: SMBus Host Controller at 0x700, revision 0 Mar 09 20:00:53 localhost kernel: i2c i2c-0: 1/1 memory slots populated (from DMI) Mar 09 20:00:53 localhost kernel: i2c i2c-0: Memory type 0x07 not supported yet, not instantiating SPD Mar 09 20:00:53 localhost systemd[1]: Starting Cloud-init: Local Stage (pre-network)... Mar 09 20:00:53 localhost systemd[1]: Starting Restore /run/initramfs on shutdown... Mar 09 20:00:53 localhost systemd[1]: Starting IPv4 firewall with iptables... Mar 09 20:00:53 localhost systemd[1]: Started irqbalance daemon. Mar 09 20:00:53 localhost systemd[1]: Load CPU microcode update was skipped because of an unmet condition check (ConditionPathExists=/sys/devices/system/cpu/microcode/reload). Mar 09 20:00:53 localhost systemd[1]: OpenSSH ecdsa Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Mar 09 20:00:53 localhost systemd[1]: OpenSSH ed25519 Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Mar 09 20:00:53 localhost systemd[1]: OpenSSH rsa Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Mar 09 20:00:53 localhost systemd[1]: Reached target sshd-keygen.target. Mar 09 20:00:53 localhost systemd[1]: System Security Services Daemon was skipped because no trigger condition checks were met. Mar 09 20:00:53 localhost systemd[1]: Reached target User and Group Name Lookups. Mar 09 20:00:53 localhost systemd[1]: Starting User Login Management... Mar 09 20:00:53 localhost systemd[1]: Started NTP client/server. Mar 09 20:00:53 localhost systemd[1]: Finished Restore /run/initramfs on shutdown. Mar 09 20:00:53 localhost kernel: kvm_amd: TSC scaling supported Mar 09 20:00:53 localhost kernel: kvm_amd: Nested Virtualization enabled Mar 09 20:00:53 localhost kernel: kvm_amd: Nested Paging enabled Mar 09 20:00:53 localhost kernel: kvm_amd: LBR virtualization supported Mar 09 20:00:53 localhost systemd-logind[828]: New seat seat0. Mar 09 20:00:53 localhost systemd-logind[828]: Watching system buttons on /dev/input/event0 (Power Button) Mar 09 20:00:53 localhost systemd-logind[828]: Watching system buttons on /dev/input/event1 (AT Translated Set 2 keyboard) Mar 09 20:00:53 localhost systemd[1]: Started User Login Management. Mar 09 20:00:53 localhost kernel: Warning: Deprecated Driver is detected: nft_compat will not be maintained in a future major release and may be disabled Mar 09 20:00:53 localhost kernel: Warning: Deprecated Driver is detected: nft_compat_module_init will not be maintained in a future major release and may be disabled Mar 09 20:00:53 localhost iptables.init[822]: iptables: Applying firewall rules: [ OK ] Mar 09 20:00:53 localhost systemd[1]: Finished IPv4 firewall with iptables. Mar 09 20:00:54 localhost cloud-init[858]: Cloud-init v. 24.4-8.el9 running 'init-local' at Tue, 10 Mar 2026 00:00:54 +0000. Up 6.71 seconds. Mar 09 20:00:54 localhost kernel: ISO 9660 Extensions: Microsoft Joliet Level 3 Mar 09 20:00:54 localhost kernel: ISO 9660 Extensions: RRIP_1991A Mar 09 20:00:54 localhost systemd[1]: run-cloud\x2dinit-tmp-tmpy_6c_g9k.mount: Deactivated successfully. Mar 09 20:00:54 localhost systemd[1]: Starting Hostname Service... Mar 09 20:00:54 localhost systemd[1]: Started Hostname Service. Mar 09 20:00:54 np0005642945.novalocal systemd-hostnamed[872]: Hostname set to (static) Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Finished Cloud-init: Local Stage (pre-network). Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Reached target Preparation for Network. Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Starting Network Manager... Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6453] NetworkManager (version 1.54.3-2.el9) is starting... (boot:7b506081-64e9-49da-a44b-eb3f30317803) Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6458] Read config: /etc/NetworkManager/NetworkManager.conf, /run/NetworkManager/conf.d/15-carrier-timeout.conf Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6599] manager[0x55ebe5b34000]: monitoring kernel firmware directory '/lib/firmware'. Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6644] hostname: hostname: using hostnamed Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6644] hostname: static hostname changed from (none) to "np0005642945.novalocal" Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6650] dns-mgr: init: dns=default,systemd-resolved rc-manager=symlink (auto) Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6737] manager[0x55ebe5b34000]: rfkill: Wi-Fi hardware radio set enabled Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6738] manager[0x55ebe5b34000]: rfkill: WWAN hardware radio set enabled Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Listening on Load/Save RF Kill Switch Status /dev/rfkill Watch. Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6831] Loaded device plugin: NMTeamFactory (/usr/lib64/NetworkManager/1.54.3-2.el9/libnm-device-plugin-team.so) Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6832] manager: rfkill: Wi-Fi enabled by radio killswitch; enabled by state file Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6833] manager: rfkill: WWAN enabled by radio killswitch; enabled by state file Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6834] manager: Networking is enabled by state file Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6837] settings: Loaded settings plugin: keyfile (internal) Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6864] settings: Loaded settings plugin: ifcfg-rh ("/usr/lib64/NetworkManager/1.54.3-2.el9/libnm-settings-plugin-ifcfg-rh.so") Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6898] Warning: the ifcfg-rh plugin is deprecated, please migrate connections to the keyfile format using "nmcli connection migrate" Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6920] dhcp: init: Using DHCP client 'internal' Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6926] manager: (lo): new Loopback device (/org/freedesktop/NetworkManager/Devices/1) Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6953] device (lo): state change: unmanaged -> unavailable (reason 'connection-assumed', managed-type: 'external') Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Starting Network Manager Script Dispatcher Service... Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6967] device (lo): state change: unavailable -> disconnected (reason 'connection-assumed', managed-type: 'external') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6984] device (lo): Activation: starting connection 'lo' (cdd555aa-6de0-433e-a477-65c95fe92ed6) Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.6997] manager: (eth0): new Ethernet device (/org/freedesktop/NetworkManager/Devices/2) Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7003] device (eth0): state change: unmanaged -> unavailable (reason 'managed', managed-type: 'external') Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Started Network Manager. Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7038] bus-manager: acquired D-Bus service "org.freedesktop.NetworkManager" Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7044] device (lo): state change: disconnected -> prepare (reason 'none', managed-type: 'external') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7048] device (lo): state change: prepare -> config (reason 'none', managed-type: 'external') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7050] device (lo): state change: config -> ip-config (reason 'none', managed-type: 'external') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7053] device (eth0): carrier: link connected Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7057] device (lo): state change: ip-config -> ip-check (reason 'none', managed-type: 'external') Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Reached target Network. Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7066] device (eth0): state change: unavailable -> disconnected (reason 'carrier-changed', managed-type: 'full') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7079] policy: auto-activating connection 'System eth0' (5fb06bd0-0bb0-7ffb-45f1-d6edd65f3e03) Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7087] device (eth0): Activation: starting connection 'System eth0' (5fb06bd0-0bb0-7ffb-45f1-d6edd65f3e03) Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7088] device (eth0): state change: disconnected -> prepare (reason 'none', managed-type: 'full') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7091] manager: NetworkManager state is now CONNECTING Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7094] device (eth0): state change: prepare -> config (reason 'none', managed-type: 'full') Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Starting Network Manager Wait Online... Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7104] device (eth0): state change: config -> ip-config (reason 'none', managed-type: 'full') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7108] dhcp4 (eth0): activation: beginning transaction (timeout in 45 seconds) Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Starting GSSAPI Proxy Daemon... Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Started Network Manager Script Dispatcher Service. Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7227] device (lo): state change: ip-check -> secondaries (reason 'none', managed-type: 'external') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7230] device (lo): state change: secondaries -> activated (reason 'none', managed-type: 'external') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.7238] device (lo): Activation: successful, device activated. Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Started GSSAPI Proxy Daemon. Mar 09 20:00:54 np0005642945.novalocal systemd[1]: RPC security service for NFS client and server was skipped because of an unmet condition check (ConditionPathExists=/etc/krb5.keytab). Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Reached target NFS client services. Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Reached target Preparation for Remote File Systems. Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Reached target Remote File Systems. Mar 09 20:00:54 np0005642945.novalocal systemd[1]: TPM2 PCR Barrier (User) was skipped because of an unmet condition check (ConditionPathExists=/sys/firmware/efi/efivars/StubPcrKernelImage-4a67b082-0a4c-41cf-b6c7-440b29bb8c4f). Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.9437] dhcp4 (eth0): state changed new lease, address=38.102.83.144 Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.9451] policy: set 'System eth0' (eth0) as default for IPv4 routing and DNS Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.9480] device (eth0): state change: ip-config -> ip-check (reason 'none', managed-type: 'full') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.9515] device (eth0): state change: ip-check -> secondaries (reason 'none', managed-type: 'full') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.9518] device (eth0): state change: secondaries -> activated (reason 'none', managed-type: 'full') Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.9522] manager: NetworkManager state is now CONNECTED_SITE Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.9527] device (eth0): Activation: successful, device activated. Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.9534] manager: NetworkManager state is now CONNECTED_GLOBAL Mar 09 20:00:54 np0005642945.novalocal NetworkManager[876]: [1773100854.9538] manager: startup complete Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Finished Network Manager Wait Online. Mar 09 20:00:54 np0005642945.novalocal systemd[1]: Starting Cloud-init: Network Stage... Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: Cloud-init v. 24.4-8.el9 running 'init' at Tue, 10 Mar 2026 00:00:55 +0000. Up 7.85 seconds. Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +++++++++++++++++++++++++++++++++++++++Net device info+++++++++++++++++++++++++++++++++++++++ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +--------+------+------------------------------+---------------+--------+-------------------+ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | Device | Up | Address | Mask | Scope | Hw-Address | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +--------+------+------------------------------+---------------+--------+-------------------+ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | eth0 | True | 38.102.83.144 | 255.255.255.0 | global | fa:16:3e:41:6e:c8 | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | eth0 | True | fe80::f816:3eff:fe41:6ec8/64 | . | link | fa:16:3e:41:6e:c8 | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | lo | True | 127.0.0.1 | 255.0.0.0 | host | . | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | lo | True | ::1/128 | . | host | . | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +--------+------+------------------------------+---------------+--------+-------------------+ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +++++++++++++++++++++++++++++++++Route IPv4 info+++++++++++++++++++++++++++++++++ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +-------+-----------------+---------------+-----------------+-----------+-------+ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | Route | Destination | Gateway | Genmask | Interface | Flags | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +-------+-----------------+---------------+-----------------+-----------+-------+ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | 0 | 0.0.0.0 | 38.102.83.1 | 0.0.0.0 | eth0 | UG | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | 1 | 38.102.83.0 | 0.0.0.0 | 255.255.255.0 | eth0 | U | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | 2 | 169.254.169.254 | 38.102.83.126 | 255.255.255.255 | eth0 | UGH | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +-------+-----------------+---------------+-----------------+-----------+-------+ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +++++++++++++++++++Route IPv6 info+++++++++++++++++++ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +-------+-------------+---------+-----------+-------+ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | Route | Destination | Gateway | Interface | Flags | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +-------+-------------+---------+-----------+-------+ Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | 1 | fe80::/64 | :: | eth0 | U | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: | 3 | multicast | :: | eth0 | U | Mar 09 20:00:55 np0005642945.novalocal cloud-init[940]: ci-info: +-------+-------------+---------+-----------+-------+ Mar 09 20:00:55 np0005642945.novalocal useradd[1007]: new group: name=cloud-user, GID=1001 Mar 09 20:00:55 np0005642945.novalocal useradd[1007]: new user: name=cloud-user, UID=1001, GID=1001, home=/home/cloud-user, shell=/bin/bash, from=none Mar 09 20:00:55 np0005642945.novalocal useradd[1007]: add 'cloud-user' to group 'adm' Mar 09 20:00:55 np0005642945.novalocal useradd[1007]: add 'cloud-user' to group 'systemd-journal' Mar 09 20:00:55 np0005642945.novalocal useradd[1007]: add 'cloud-user' to shadow group 'adm' Mar 09 20:00:55 np0005642945.novalocal useradd[1007]: add 'cloud-user' to shadow group 'systemd-journal' Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: Generating public/private rsa key pair. Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: Your identification has been saved in /etc/ssh/ssh_host_rsa_key Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: Your public key has been saved in /etc/ssh/ssh_host_rsa_key.pub Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: The key fingerprint is: Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: SHA256:sxfdHXj3auUSuEo7qiCP+QUsiS/qklrdPsGQTwOhGP4 root@np0005642945.novalocal Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: The key's randomart image is: Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: +---[RSA 3072]----+ Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |. .. | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |.o .. . | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |... o . o.| Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | ..oo o . o..+| Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |. oEo= .S . o o +| Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | . o o+ o . . = | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |..+ o o.. o . + .| Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |+o = +. o.o . . | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |*.o.o oo..o. | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: +----[SHA256]-----+ Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: Generating public/private ecdsa key pair. Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: Your identification has been saved in /etc/ssh/ssh_host_ecdsa_key Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: Your public key has been saved in /etc/ssh/ssh_host_ecdsa_key.pub Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: The key fingerprint is: Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: SHA256:Sc6rgoikZq4Mzan2h6cRu2tGatOQYYbpiqM357sk2N8 root@np0005642945.novalocal Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: The key's randomart image is: Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: +---[ECDSA 256]---+ Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |.. . | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |o+ + . | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |+ o. S | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | X oo . | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |O.@+o . | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |XO+O=+ . | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: |%==OX+E | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: +----[SHA256]-----+ Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: Generating public/private ed25519 key pair. Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: Your identification has been saved in /etc/ssh/ssh_host_ed25519_key Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: Your public key has been saved in /etc/ssh/ssh_host_ed25519_key.pub Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: The key fingerprint is: Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: SHA256:AZyyd0eYCo1fdFkl+B2LnTWSfNlx1Bc8U4+e4G0uU9A root@np0005642945.novalocal Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: The key's randomart image is: Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: +--[ED25519 256]--+ Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | +.o.o.++.++@| Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | + +.+.+ *.OB| Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | = o.. .o+E=*| Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | . + ....o==. | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | . .S. . * | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | + | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | o . | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | o | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: | | Mar 09 20:00:56 np0005642945.novalocal cloud-init[940]: +----[SHA256]-----+ Mar 09 20:00:56 np0005642945.novalocal sm-notify[1023]: Version 2.5.4 starting Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Finished Cloud-init: Network Stage. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Reached target Cloud-config availability. Mar 09 20:00:56 np0005642945.novalocal sshd[1025]: Server listening on 0.0.0.0 port 22. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Reached target Network is Online. Mar 09 20:00:56 np0005642945.novalocal sshd[1025]: Server listening on :: port 22. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Starting Cloud-init: Config Stage... Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Starting Crash recovery kernel arming... Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Starting Notify NFS peers of a restart... Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Starting System Logging Service... Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Starting OpenSSH server daemon... Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Starting Permit User Sessions... Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Started Notify NFS peers of a restart. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Finished Permit User Sessions. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Started OpenSSH server daemon. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Started Command Scheduler. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Started Getty on tty1. Mar 09 20:00:56 np0005642945.novalocal crond[1028]: (CRON) STARTUP (1.5.7) Mar 09 20:00:56 np0005642945.novalocal crond[1028]: (CRON) INFO (Syslog will be used instead of sendmail.) Mar 09 20:00:56 np0005642945.novalocal crond[1028]: (CRON) INFO (RANDOM_DELAY will be scaled with factor 49% if used.) Mar 09 20:00:56 np0005642945.novalocal crond[1028]: (CRON) INFO (running with inotify support) Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Started Serial Getty on ttyS0. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Reached target Login Prompts. Mar 09 20:00:56 np0005642945.novalocal rsyslogd[1024]: [origin software="rsyslogd" swVersion="8.2510.0-2.el9" x-pid="1024" x-info="https://www.rsyslog.com"] start Mar 09 20:00:56 np0005642945.novalocal rsyslogd[1024]: imjournal: No statefile exists, /var/lib/rsyslog/imjournal.state will be created (ignore if this is first run): No such file or directory [v8.2510.0-2.el9 try https://www.rsyslog.com/e/2040 ] Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Started System Logging Service. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Reached target Multi-User System. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Starting Record Runlevel Change in UTMP... Mar 09 20:00:56 np0005642945.novalocal systemd[1]: systemd-update-utmp-runlevel.service: Deactivated successfully. Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Finished Record Runlevel Change in UTMP. Mar 09 20:00:56 np0005642945.novalocal rsyslogd[1024]: imjournal: journal files changed, reloading... [v8.2510.0-2.el9 try https://www.rsyslog.com/e/0 ] Mar 09 20:00:56 np0005642945.novalocal sshd-session[1144]: Unable to negotiate with 38.102.83.114 port 54576: no matching host key type found. Their offer: ssh-ed25519,ssh-ed25519-cert-v01@openssh.com [preauth] Mar 09 20:00:56 np0005642945.novalocal sshd-session[1157]: Unable to negotiate with 38.102.83.114 port 54584: no matching host key type found. Their offer: ecdsa-sha2-nistp384,ecdsa-sha2-nistp384-cert-v01@openssh.com [preauth] Mar 09 20:00:56 np0005642945.novalocal cloud-init[1158]: Cloud-init v. 24.4-8.el9 running 'modules:config' at Tue, 10 Mar 2026 00:00:56 +0000. Up 9.26 seconds. Mar 09 20:00:56 np0005642945.novalocal sshd-session[1160]: Unable to negotiate with 38.102.83.114 port 54598: no matching host key type found. Their offer: ecdsa-sha2-nistp521,ecdsa-sha2-nistp521-cert-v01@openssh.com [preauth] Mar 09 20:00:56 np0005642945.novalocal sshd-session[1164]: Connection reset by 38.102.83.114 port 54610 [preauth] Mar 09 20:00:56 np0005642945.novalocal sshd-session[1122]: Connection closed by 38.102.83.114 port 43676 [preauth] Mar 09 20:00:56 np0005642945.novalocal kdumpctl[1033]: kdump: No kdump initial ramdisk found. Mar 09 20:00:56 np0005642945.novalocal kdumpctl[1033]: kdump: Rebuilding /boot/initramfs-5.14.0-687.el9.x86_64kdump.img Mar 09 20:00:56 np0005642945.novalocal sshd-session[1150]: Connection closed by 38.102.83.114 port 54580 [preauth] Mar 09 20:00:56 np0005642945.novalocal sshd-session[1189]: Unable to negotiate with 38.102.83.114 port 54626: no matching host key type found. Their offer: ssh-rsa,ssh-rsa-cert-v01@openssh.com [preauth] Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Finished Cloud-init: Config Stage. Mar 09 20:00:56 np0005642945.novalocal sshd-session[1201]: Unable to negotiate with 38.102.83.114 port 54628: no matching host key type found. Their offer: ssh-dss,ssh-dss-cert-v01@openssh.com [preauth] Mar 09 20:00:56 np0005642945.novalocal systemd[1]: Starting Cloud-init: Final Stage... Mar 09 20:00:56 np0005642945.novalocal sshd-session[1176]: Connection closed by 38.102.83.114 port 54620 [preauth] Mar 09 20:00:57 np0005642945.novalocal cloud-init[1417]: Cloud-init v. 24.4-8.el9 running 'modules:final' at Tue, 10 Mar 2026 00:00:57 +0000. Up 9.68 seconds. Mar 09 20:00:57 np0005642945.novalocal cloud-init[1456]: ############################################################# Mar 09 20:00:57 np0005642945.novalocal cloud-init[1458]: -----BEGIN SSH HOST KEY FINGERPRINTS----- Mar 09 20:00:57 np0005642945.novalocal cloud-init[1469]: 256 SHA256:Sc6rgoikZq4Mzan2h6cRu2tGatOQYYbpiqM357sk2N8 root@np0005642945.novalocal (ECDSA) Mar 09 20:00:57 np0005642945.novalocal cloud-init[1478]: 256 SHA256:AZyyd0eYCo1fdFkl+B2LnTWSfNlx1Bc8U4+e4G0uU9A root@np0005642945.novalocal (ED25519) Mar 09 20:00:57 np0005642945.novalocal cloud-init[1485]: 3072 SHA256:sxfdHXj3auUSuEo7qiCP+QUsiS/qklrdPsGQTwOhGP4 root@np0005642945.novalocal (RSA) Mar 09 20:00:57 np0005642945.novalocal cloud-init[1486]: -----END SSH HOST KEY FINGERPRINTS----- Mar 09 20:00:57 np0005642945.novalocal cloud-init[1488]: ############################################################# Mar 09 20:00:57 np0005642945.novalocal cloud-init[1417]: Cloud-init v. 24.4-8.el9 finished at Tue, 10 Mar 2026 00:00:57 +0000. Datasource DataSourceConfigDrive [net,ver=2][source=/dev/sr0]. Up 9.88 seconds Mar 09 20:00:57 np0005642945.novalocal systemd[1]: Finished Cloud-init: Final Stage. Mar 09 20:00:57 np0005642945.novalocal systemd[1]: Reached target Cloud-init target. Mar 09 20:00:57 np0005642945.novalocal dracut[1547]: dracut-057-110.git20260130.el9 Mar 09 20:00:57 np0005642945.novalocal dracut[1549]: Executing: /usr/bin/dracut --quiet --hostonly --hostonly-cmdline --hostonly-i18n --hostonly-mode strict --hostonly-nics --mount "/dev/disk/by-uuid/d70e3b08-39eb-4644-ba12-579a10c34a4e /sysroot xfs rw,relatime,seclabel,attr2,inode64,logbufs=8,logbsize=32k,noquota" --squash-compressor zstd --no-hostonly-default-device --add-confdir /lib/kdump/dracut.conf.d -f /boot/initramfs-5.14.0-687.el9.x86_64kdump.img 5.14.0-687.el9.x86_64 Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-networkd' will not be installed, because command 'networkctl' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-networkd' will not be installed, because command '/usr/lib/systemd/systemd-networkd' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-networkd' will not be installed, because command '/usr/lib/systemd/systemd-networkd-wait-online' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-resolved' will not be installed, because command 'resolvectl' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-resolved' will not be installed, because command '/usr/lib/systemd/systemd-resolved' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-timesyncd' will not be installed, because command '/usr/lib/systemd/systemd-timesyncd' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-timesyncd' will not be installed, because command '/usr/lib/systemd/systemd-time-wait-sync' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'busybox' will not be installed, because command 'busybox' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'dbus-daemon' will not be installed, because command 'dbus-daemon' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'rngd' will not be installed, because command 'rngd' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'connman' will not be installed, because command 'connmand' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'connman' will not be installed, because command 'connmanctl' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'connman' will not be installed, because command 'connmand-wait-online' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'network-wicked' will not be installed, because command 'wicked' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: Module 'ifcfg' will not be installed, because it's in the list to be omitted! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: Module 'plymouth' will not be installed, because it's in the list to be omitted! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: 62bluetooth: Could not find any command of '/usr/lib/bluetooth/bluetoothd /usr/libexec/bluetooth/bluetoothd'! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'lvmmerge' will not be installed, because command 'lvm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'lvmthinpool-monitor' will not be installed, because command 'lvm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'btrfs' will not be installed, because command 'btrfs' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'dmraid' will not be installed, because command 'dmraid' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'lvm' will not be installed, because command 'lvm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'mdraid' will not be installed, because command 'mdadm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'pcsc' will not be installed, because command 'pcscd' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'tpm2-tss' will not be installed, because command 'tpm2' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'cifs' will not be installed, because command 'mount.cifs' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'iscsi' will not be installed, because command 'iscsi-iname' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'iscsi' will not be installed, because command 'iscsiadm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'iscsi' will not be installed, because command 'iscsid' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'nvmf' will not be installed, because command 'nvme' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: Module 'resume' will not be installed, because it's in the list to be omitted! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'biosdevname' will not be installed, because command 'biosdevname' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: Module 'earlykdump' will not be installed, because it's in the list to be omitted! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'memstrack' will not be installed, because command 'memstrack' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: memstrack is not available Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: If you need to use rd.memdebug>=4, please install memstrack and procps-ng Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-resolved' will not be installed, because command 'resolvectl' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-resolved' will not be installed, because command '/usr/lib/systemd/systemd-resolved' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-timesyncd' will not be installed, because command '/usr/lib/systemd/systemd-timesyncd' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'systemd-timesyncd' will not be installed, because command '/usr/lib/systemd/systemd-time-wait-sync' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'busybox' will not be installed, because command 'busybox' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'dbus-daemon' will not be installed, because command 'dbus-daemon' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'rngd' will not be installed, because command 'rngd' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'connman' will not be installed, because command 'connmand' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'connman' will not be installed, because command 'connmanctl' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'connman' will not be installed, because command 'connmand-wait-online' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'network-wicked' will not be installed, because command 'wicked' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: 62bluetooth: Could not find any command of '/usr/lib/bluetooth/bluetoothd /usr/libexec/bluetooth/bluetoothd'! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'lvmmerge' will not be installed, because command 'lvm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'lvmthinpool-monitor' will not be installed, because command 'lvm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'btrfs' will not be installed, because command 'btrfs' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'dmraid' will not be installed, because command 'dmraid' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'lvm' will not be installed, because command 'lvm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'mdraid' will not be installed, because command 'mdadm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'pcsc' will not be installed, because command 'pcscd' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'tpm2-tss' will not be installed, because command 'tpm2' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'cifs' will not be installed, because command 'mount.cifs' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'iscsi' will not be installed, because command 'iscsi-iname' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'iscsi' will not be installed, because command 'iscsiadm' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'iscsi' will not be installed, because command 'iscsid' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'nvmf' will not be installed, because command 'nvme' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: dracut module 'memstrack' will not be installed, because command 'memstrack' could not be found! Mar 09 20:00:58 np0005642945.novalocal dracut[1549]: memstrack is not available Mar 09 20:00:59 np0005642945.novalocal dracut[1549]: If you need to use rd.memdebug>=4, please install memstrack and procps-ng Mar 09 20:00:59 np0005642945.novalocal dracut[1549]: *** Including module: systemd *** Mar 09 20:00:59 np0005642945.novalocal dracut[1549]: *** Including module: fips *** Mar 09 20:00:59 np0005642945.novalocal dracut[1549]: *** Including module: systemd-initrd *** Mar 09 20:00:59 np0005642945.novalocal dracut[1549]: *** Including module: i18n *** Mar 09 20:00:59 np0005642945.novalocal dracut[1549]: *** Including module: drm *** Mar 09 20:00:59 np0005642945.novalocal chronyd[816]: Selected source 167.160.187.179 (2.centos.pool.ntp.org) Mar 09 20:00:59 np0005642945.novalocal chronyd[816]: System clock TAI offset set to 37 seconds Mar 09 20:01:00 np0005642945.novalocal dracut[1549]: *** Including module: prefixdevname *** Mar 09 20:01:00 np0005642945.novalocal dracut[1549]: *** Including module: kernel-modules *** Mar 09 20:01:00 np0005642945.novalocal kernel: block vda: the capability attribute has been deprecated. Mar 09 20:01:00 np0005642945.novalocal dracut[1549]: *** Including module: kernel-modules-extra *** Mar 09 20:01:00 np0005642945.novalocal dracut[1549]: kernel-modules-extra: configuration source "/run/depmod.d" does not exist Mar 09 20:01:00 np0005642945.novalocal dracut[1549]: kernel-modules-extra: configuration source "/lib/depmod.d" does not exist Mar 09 20:01:00 np0005642945.novalocal dracut[1549]: kernel-modules-extra: parsing configuration file "/etc/depmod.d/dist.conf" Mar 09 20:01:00 np0005642945.novalocal dracut[1549]: kernel-modules-extra: /etc/depmod.d/dist.conf: added "updates extra built-in weak-updates" to the list of search directories Mar 09 20:01:00 np0005642945.novalocal dracut[1549]: *** Including module: qemu *** Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: *** Including module: fstab-sys *** Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: *** Including module: rootfs-block *** Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: *** Including module: terminfo *** Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: *** Including module: udev-rules *** Mar 09 20:01:01 np0005642945.novalocal CROND[2802]: (root) CMD (run-parts /etc/cron.hourly) Mar 09 20:01:01 np0005642945.novalocal run-parts[2809]: (/etc/cron.hourly) starting 0anacron Mar 09 20:01:01 np0005642945.novalocal anacron[2824]: Anacron started on 2026-03-09 Mar 09 20:01:01 np0005642945.novalocal anacron[2824]: Will run job `cron.daily' in 21 min. Mar 09 20:01:01 np0005642945.novalocal anacron[2824]: Will run job `cron.weekly' in 41 min. Mar 09 20:01:01 np0005642945.novalocal anacron[2824]: Will run job `cron.monthly' in 61 min. Mar 09 20:01:01 np0005642945.novalocal anacron[2824]: Jobs will be executed sequentially Mar 09 20:01:01 np0005642945.novalocal run-parts[2827]: (/etc/cron.hourly) finished 0anacron Mar 09 20:01:01 np0005642945.novalocal CROND[2799]: (root) CMDEND (run-parts /etc/cron.hourly) Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: Skipping udev rule: 91-permissions.rules Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: Skipping udev rule: 80-drivers-modprobe.rules Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: *** Including module: virtiofs *** Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: *** Including module: dracut-systemd *** Mar 09 20:01:01 np0005642945.novalocal chronyd[816]: Selected source 149.56.19.163 (2.centos.pool.ntp.org) Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: *** Including module: usrmount *** Mar 09 20:01:01 np0005642945.novalocal dracut[1549]: *** Including module: base *** Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: *** Including module: fs-lib *** Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: *** Including module: kdumpbase *** Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: *** Including module: microcode_ctl-fw_dir_override *** Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl module: mangling fw_dir Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: reset fw_dir to "/lib/firmware/updates /lib/firmware" Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel"... Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel" is ignored Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-2d-07"... Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel-06-2d-07" is ignored Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-4e-03"... Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel-06-4e-03" is ignored Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-4f-01"... Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel-06-4f-01" is ignored Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-55-04"... Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel-06-55-04" is ignored Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-5e-03"... Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel-06-5e-03" is ignored Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-8c-01"... Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel-06-8c-01" is ignored Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-8e-9e-0x-0xca"... Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel-06-8e-9e-0x-0xca" is ignored Mar 09 20:01:02 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-8e-9e-0x-dell"... Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel-06-8e-9e-0x-dell" is ignored Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-8f-08"... Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: microcode_ctl: configuration "intel-06-8f-08" is ignored Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: microcode_ctl: final fw_dir: "/lib/firmware/updates /lib/firmware" Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: *** Including module: openssl *** Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: *** Including module: shutdown *** Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: *** Including module: squash *** Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: *** Including modules done *** Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: *** Installing kernel module dependencies *** Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: Cannot change IRQ 35 affinity: Operation not permitted Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: IRQ 35 affinity is now unmanaged Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: Cannot change IRQ 33 affinity: Operation not permitted Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: IRQ 33 affinity is now unmanaged Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: Cannot change IRQ 31 affinity: Operation not permitted Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: IRQ 31 affinity is now unmanaged Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: Cannot change IRQ 28 affinity: Operation not permitted Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: IRQ 28 affinity is now unmanaged Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: Cannot change IRQ 34 affinity: Operation not permitted Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: IRQ 34 affinity is now unmanaged Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: Cannot change IRQ 32 affinity: Operation not permitted Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: IRQ 32 affinity is now unmanaged Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: Cannot change IRQ 30 affinity: Operation not permitted Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: IRQ 30 affinity is now unmanaged Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: Cannot change IRQ 29 affinity: Operation not permitted Mar 09 20:01:03 np0005642945.novalocal irqbalance[826]: IRQ 29 affinity is now unmanaged Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: *** Installing kernel module dependencies done *** Mar 09 20:01:03 np0005642945.novalocal dracut[1549]: *** Resolving executable dependencies *** Mar 09 20:01:05 np0005642945.novalocal systemd[1]: NetworkManager-dispatcher.service: Deactivated successfully. Mar 09 20:01:05 np0005642945.novalocal dracut[1549]: *** Resolving executable dependencies done *** Mar 09 20:01:05 np0005642945.novalocal dracut[1549]: *** Generating early-microcode cpio image *** Mar 09 20:01:05 np0005642945.novalocal dracut[1549]: *** Store current command line parameters *** Mar 09 20:01:05 np0005642945.novalocal dracut[1549]: Stored kernel commandline: Mar 09 20:01:05 np0005642945.novalocal dracut[1549]: No dracut internal kernel commandline stored in the initramfs Mar 09 20:01:05 np0005642945.novalocal dracut[1549]: *** Install squash loader *** Mar 09 20:01:06 np0005642945.novalocal dracut[1549]: *** Squashing the files inside the initramfs *** Mar 09 20:01:06 np0005642945.novalocal sshd-session[4599]: Accepted publickey for zuul-worker from 38.102.83.114 port 41142 ssh2: RSA SHA256:zhs3MiW0JhxzckYcMHQES8SMYHj1iGcomnyzmbiwor8 Mar 09 20:01:06 np0005642945.novalocal systemd[1]: Created slice User Slice of UID 1000. Mar 09 20:01:06 np0005642945.novalocal systemd[1]: Starting User Runtime Directory /run/user/1000... Mar 09 20:01:06 np0005642945.novalocal systemd-logind[828]: New session 1 of user zuul-worker. Mar 09 20:01:06 np0005642945.novalocal systemd[1]: Finished User Runtime Directory /run/user/1000. Mar 09 20:01:06 np0005642945.novalocal systemd[1]: Starting User Manager for UID 1000... Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: pam_unix(systemd-user:session): session opened for user zuul-worker(uid=1000) by zuul-worker(uid=0) Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Queued start job for default target Main User Target. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Created slice User Application Slice. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Started Mark boot as successful after the user session has run 2 minutes. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Started Daily Cleanup of User's Temporary Directories. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Reached target Paths. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Reached target Timers. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Starting D-Bus User Message Bus Socket... Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Starting Create User's Volatile Files and Directories... Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Finished Create User's Volatile Files and Directories. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Listening on D-Bus User Message Bus Socket. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Reached target Sockets. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Reached target Basic System. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Reached target Main User Target. Mar 09 20:01:06 np0005642945.novalocal systemd[4603]: Startup finished in 105ms. Mar 09 20:01:06 np0005642945.novalocal systemd[1]: Started User Manager for UID 1000. Mar 09 20:01:06 np0005642945.novalocal systemd[1]: Started Session 1 of User zuul-worker. Mar 09 20:01:06 np0005642945.novalocal sshd-session[4599]: pam_unix(sshd:session): session opened for user zuul-worker(uid=1000) by zuul-worker(uid=0) Mar 09 20:01:07 np0005642945.novalocal python3[4683]: ansible-setup Invoked with gather_subset=['!all'] gather_timeout=10 filter=[] fact_path=/etc/ansible/facts.d Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: *** Squashing the files inside the initramfs done *** Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: *** Creating image file '/boot/initramfs-5.14.0-687.el9.x86_64kdump.img' *** Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: *** Hardlinking files *** Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: Mode: real Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: Files: 50 Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: Linked: 0 files Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: Compared: 0 xattrs Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: Compared: 0 files Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: Saved: 0 B Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: Duration: 0.000551 seconds Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: *** Hardlinking files done *** Mar 09 20:01:07 np0005642945.novalocal dracut[1549]: *** Creating initramfs image file '/boot/initramfs-5.14.0-687.el9.x86_64kdump.img' done *** Mar 09 20:01:08 np0005642945.novalocal kdumpctl[1033]: kdump: kexec: loaded kdump kernel Mar 09 20:01:08 np0005642945.novalocal kdumpctl[1033]: kdump: Starting kdump: [OK] Mar 09 20:01:08 np0005642945.novalocal systemd[1]: Finished Crash recovery kernel arming. Mar 09 20:01:08 np0005642945.novalocal systemd[1]: Startup finished in 1.476s (kernel) + 2.724s (initrd) + 16.806s (userspace) = 21.007s. Mar 09 20:01:08 np0005642945.novalocal python3[4926]: ansible-ansible.legacy.setup Invoked with gather_subset=['all'] gather_timeout=10 filter=[] fact_path=/etc/ansible/facts.d Mar 09 20:01:13 np0005642945.novalocal python3[4984]: ansible-setup Invoked with gather_subset=['network'] gather_timeout=10 filter=[] fact_path=/etc/ansible/facts.d Mar 09 20:01:13 np0005642945.novalocal python3[5024]: ansible-zuul_console Invoked with path=/tmp/console-{log_uuid}.log port=19885 state=present Mar 09 20:01:15 np0005642945.novalocal python3[5050]: ansible-authorized_key Invoked with user=zuul-worker state=present key=ssh-rsa AAAAB3NzaC1yc2EAAAADAQABAAABgQC9Mvdr+SMsWPe/kadlbxA7snartQxrfzSfUzGC8d/Pt3godMbD2MiTSpCvRFJ3goCYlGpSa3MOm19zP6j90BIXIfkheN4XEXuvUdjx4sPwgqgBXXuslLA7+IXgH+nj/OKN+qU1ZRTb7mOsENCAax7Ylq8YJleRbbfjEbHKI5H3WKUOOBZyWyFUSQwUR6O2a7zTfilhW7v//LqbeAebqeX1NS/Ui9C2oGI8GmE+WzR7N3kux0Ja5oZTZSTMDZi/+sQLeMqIH3WRvzFL25S6BSDk1ohvjgZEICsT2p9/o9PSK7viFT9QGJREl4m6m31QZkJQMT3/BAVpGDON8pCvWSZf+RwV6LPvbytLk5PEwOgQIwP/idX766kJUYMNEZpAffLKdBuioRCnxYgvtO3/R21B0Z9J0NsUmRCE/goSKvPmfaADZR3DgqrlHrpek+lUPiRJhKvTwJqWMds1X/nKMpNyblveDAz9Nzdatorzx+xZ4jLnd5DhzUrVguW84SAZ4Z0= zuul-build-sshkey manage_dir=True exclusive=False validate_certs=True follow=False path=None key_options=None comment=None Mar 09 20:01:15 np0005642945.novalocal python3[5074]: ansible-file Invoked with state=directory path=/home/zuul-worker/.ssh mode=448 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:16 np0005642945.novalocal python3[5173]: ansible-ansible.legacy.stat Invoked with path=/home/zuul-worker/.ssh/id_rsa follow=False get_checksum=False checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Mar 09 20:01:16 np0005642945.novalocal python3[5244]: ansible-ansible.legacy.copy Invoked with src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1773100875.7419553-163-258002263758980/source dest=/home/zuul-worker/.ssh/id_rsa mode=384 force=False _original_basename=e547587cd22d4a6e8ef94df6696f0d39_id_rsa follow=False checksum=e4fc86395c197f5f2d277fd10bd665f794b61750 backup=False unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:16 np0005642945.novalocal python3[5367]: ansible-ansible.legacy.stat Invoked with path=/home/zuul-worker/.ssh/id_rsa.pub follow=False get_checksum=False checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Mar 09 20:01:17 np0005642945.novalocal python3[5438]: ansible-ansible.legacy.copy Invoked with src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1773100876.5899596-174-38357147556451/source dest=/home/zuul-worker/.ssh/id_rsa.pub mode=420 force=False _original_basename=e547587cd22d4a6e8ef94df6696f0d39_id_rsa.pub follow=False checksum=58d6f9e91bca57ecdb566c5841bc1855e4b1db78 backup=False unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:18 np0005642945.novalocal python3[5486]: ansible-ping Invoked with data=pong Mar 09 20:01:19 np0005642945.novalocal python3[5510]: ansible-setup Invoked with gather_subset=['all'] gather_timeout=10 filter=[] fact_path=/etc/ansible/facts.d Mar 09 20:01:20 np0005642945.novalocal python3[5568]: ansible-zuul_debug_info Invoked with ipv4_route_required=False ipv6_route_required=False image_manifest_files=['/etc/dib-builddate.txt', '/etc/image-hostname.txt'] image_manifest=None traceroute_host=None Mar 09 20:01:21 np0005642945.novalocal python3[5600]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/logs state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:21 np0005642945.novalocal python3[5624]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/artifacts state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:21 np0005642945.novalocal python3[5648]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/docs state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:22 np0005642945.novalocal python3[5672]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/logs state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:22 np0005642945.novalocal python3[5696]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/artifacts state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:22 np0005642945.novalocal python3[5720]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/docs state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:24 np0005642945.novalocal systemd[1]: systemd-hostnamed.service: Deactivated successfully. Mar 09 20:01:25 np0005642945.novalocal python3[5746]: ansible-zuul_console Invoked with path=/tmp/console-{log_uuid}.log port=19885 state=present Mar 09 20:01:25 np0005642945.novalocal sshd-session[5749]: Accepted publickey for zuul-worker from 38.102.83.114 port 45004 ssh2: RSA SHA256:m5omLASsq61hRBZ0yM3YORaaYyt0k+uT4/b7Gul50as Mar 09 20:01:25 np0005642945.novalocal systemd-logind[828]: New session 3 of user zuul-worker. Mar 09 20:01:25 np0005642945.novalocal systemd[1]: Started Session 3 of User zuul-worker. Mar 09 20:01:25 np0005642945.novalocal sshd-session[5749]: pam_unix(sshd:session): session opened for user zuul-worker(uid=1000) by zuul-worker(uid=0) Mar 09 20:01:28 np0005642945.novalocal sshd-session[5752]: Received disconnect from 38.102.83.114 port 45004:11: disconnected by user Mar 09 20:01:28 np0005642945.novalocal sshd-session[5752]: Disconnected from user zuul-worker 38.102.83.114 port 45004 Mar 09 20:01:28 np0005642945.novalocal sshd-session[5749]: pam_unix(sshd:session): session closed for user zuul-worker Mar 09 20:01:28 np0005642945.novalocal systemd[1]: session-3.scope: Deactivated successfully. Mar 09 20:01:28 np0005642945.novalocal systemd[1]: session-3.scope: Consumed 1.351s CPU time. Mar 09 20:01:28 np0005642945.novalocal systemd-logind[828]: Session 3 logged out. Waiting for processes to exit. Mar 09 20:01:28 np0005642945.novalocal systemd-logind[828]: Removed session 3. Mar 09 20:01:28 np0005642945.novalocal python3[5800]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/logs state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:28 np0005642945.novalocal python3[5824]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/artifacts state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:28 np0005642945.novalocal python3[5848]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/docs state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:29 np0005642945.novalocal python3[5872]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/logs state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:29 np0005642945.novalocal python3[5896]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/artifacts state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:29 np0005642945.novalocal python3[5920]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/docs state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:30 np0005642945.novalocal python3[5945]: ansible-ansible.legacy.command Invoked with _raw_params=sudo -n true zuul_log_id=fa163e3b-3c83-22cc-bb0f-000000000028-1-cloudcentos9stream zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:01:30 np0005642945.novalocal sudo[5946]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/true Mar 09 20:01:30 np0005642945.novalocal sudo[5946]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:30 np0005642945.novalocal sudo[5946]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:31 np0005642945.novalocal python3[5974]: ansible-file Invoked with path=/home/zuul-worker/.pydistutils.cfg state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:32 np0005642945.novalocal sudo[6050]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fnbowiqwslgvypvzorchqbynycaffeaf ; /usr/bin/python3' Mar 09 20:01:32 np0005642945.novalocal sudo[6050]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:32 np0005642945.novalocal python3[6052]: ansible-ansible.legacy.stat Invoked with path=/etc/pip.conf follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Mar 09 20:01:32 np0005642945.novalocal sudo[6050]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:32 np0005642945.novalocal sudo[6123]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pycaqrtjsldiacfuuaihxxcownbzxpzh ; /usr/bin/python3' Mar 09 20:01:32 np0005642945.novalocal sudo[6123]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:32 np0005642945.novalocal python3[6125]: ansible-ansible.legacy.copy Invoked with dest=/etc/pip.conf group=root mode=420 owner=root src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1773100892.0058718-91-28145424128633/source follow=False _original_basename=pip.conf.j2 checksum=5b65c9094402b8db60a77928be1f816342638afe backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:32 np0005642945.novalocal sudo[6123]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:33 np0005642945.novalocal sudo[6225]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hazijwfjtwqptbwrekqwcxdghtskhgqd ; /usr/bin/python3' Mar 09 20:01:33 np0005642945.novalocal sudo[6225]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:33 np0005642945.novalocal python3[6227]: ansible-ansible.legacy.stat Invoked with path=/etc/yum.repos.d/centos.repo follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Mar 09 20:01:33 np0005642945.novalocal sudo[6225]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:33 np0005642945.novalocal sudo[6300]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uhtkgvscuasyvzgmjbtbrqvigmeytdbl ; /usr/bin/python3' Mar 09 20:01:33 np0005642945.novalocal sudo[6300]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:33 np0005642945.novalocal python3[6302]: ansible-ansible.legacy.copy Invoked with dest=/etc/yum.repos.d/centos.repo group=root mode=420 owner=root src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1773100893.0644846-103-186233424478136/source follow=False _original_basename=centos.repo.j2 checksum=0268eb1686bc9b047a2096dbaf287658b0d20a19 backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:33 np0005642945.novalocal sudo[6300]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:34 np0005642945.novalocal sudo[6402]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wgszuiiqpihlmidjrcjvjbotrrlxjels ; /usr/bin/python3' Mar 09 20:01:34 np0005642945.novalocal sudo[6402]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:34 np0005642945.novalocal python3[6404]: ansible-ansible.legacy.stat Invoked with path=/etc/yum.repos.d/centos-addons.repo follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Mar 09 20:01:34 np0005642945.novalocal sudo[6402]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:34 np0005642945.novalocal sudo[6477]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wdsqeovyghjzeahytvoblclgdxyivnmh ; /usr/bin/python3' Mar 09 20:01:34 np0005642945.novalocal sudo[6477]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:34 np0005642945.novalocal python3[6479]: ansible-ansible.legacy.copy Invoked with dest=/etc/yum.repos.d/centos-addons.repo group=root mode=420 owner=root src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1773100893.974558-103-24041096455476/source follow=False _original_basename=centos-addons.repo.j2 checksum=2917e612982cadeb3009a3bf37bf30cbcd7f2044 backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:34 np0005642945.novalocal sudo[6477]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:35 np0005642945.novalocal sudo[6527]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jzmmtkzaomjayluizewtkqncrykycmhb ; /usr/bin/python3' Mar 09 20:01:35 np0005642945.novalocal sudo[6527]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:35 np0005642945.novalocal python3[6529]: ansible-ini_file Invoked with path=/etc/dnf.conf section=main option=deltarpm value=0 mode=420 backup=False state=present exclusive=True no_extra_spaces=False ignore_spaces=False allow_no_value=False create=True follow=False unsafe_writes=False values=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:35 np0005642945.novalocal python3[6529]: ansible-ini_file [WARNING] Module remote_tmp /root/.ansible/tmp did not exist and was created with a mode of 0700, this may cause issues when running as another user. To avoid this, create the remote_tmp dir with the correct permissions manually Mar 09 20:01:35 np0005642945.novalocal sudo[6527]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:35 np0005642945.novalocal sudo[6553]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dboqkymcutgjbismsixwnitvlwbdrdkw ; /usr/bin/python3' Mar 09 20:01:35 np0005642945.novalocal sudo[6553]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:35 np0005642945.novalocal python3[6555]: ansible-ansible.legacy.command Invoked with _raw_params=dnf clean all zuul_log_id=in-loop-ignore zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:01:36 np0005642945.novalocal sudo[6553]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:36 np0005642945.novalocal sudo[6581]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nryfxvulfzxkwcxhtjtnoeodqyotjfeq ; /usr/bin/python3' Mar 09 20:01:36 np0005642945.novalocal sudo[6581]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:36 np0005642945.novalocal python3[6583]: ansible-ansible.legacy.command Invoked with _raw_params=dnf makecache -v zuul_log_id=in-loop-ignore zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:01:47 np0005642945.novalocal sudo[6581]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:48 np0005642945.novalocal python3[6625]: ansible-file Invoked with path=/home/zuul-worker/workspace state=directory recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:01:49 np0005642945.novalocal python3[6650]: ansible-ansible.legacy.command Invoked with executable=/bin/bash _raw_params=PYTHON2=0 PYTHON3=1 # Not all platforms install a `pip` when installing python # specific pip packages. We first check if pip$VERSION is # available and if not fallback to checking if just `pip` # is present. if [ "$PYTHON2" -eq "1" ] ; then command -v pip2 || command -v pip || exit 1 python2 -m wheel --help || exit 1 fi if [ "$PYTHON3" -eq "1" ] ; then command -v pip3 || command -v pip || exit 1 python3 -m wheel --help || exit 1 fi _uses_shell=True zuul_log_id=fa163e3b-3c83-76d0-79de-0000000000a3-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None creates=None removes=None stdin=None Mar 09 20:01:50 np0005642945.novalocal sudo[6678]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rzjjlhxrolejswwglsjeezuiqegailwh ; /usr/bin/python3' Mar 09 20:01:50 np0005642945.novalocal sudo[6678]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:51 np0005642945.novalocal python3[6680]: ansible-ansible.legacy.dnf Invoked with name=['python3-pip', 'python3-setuptools'] state=present allow_downgrade=False autoremove=False bugfix=False cacheonly=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True sslverify=True lock_timeout=30 allowerasing=False nobest=False use_backend=auto conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:01:52 np0005642945.novalocal sudo[6678]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:52 np0005642945.novalocal sudo[6705]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xswksgcgpdilcdyudsdeyczaetgjqctj ; /usr/bin/python3' Mar 09 20:01:52 np0005642945.novalocal sudo[6705]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:01:52 np0005642945.novalocal python3[6707]: ansible-ansible.legacy.dnf Invoked with name=['python3-wheel'] state=present allow_downgrade=False autoremove=False bugfix=False cacheonly=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True sslverify=True lock_timeout=30 allowerasing=False nobest=False use_backend=auto conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:01:53 np0005642945.novalocal sudo[6705]: pam_unix(sudo:session): session closed for user root Mar 09 20:01:54 np0005642945.novalocal python3[6739]: ansible-ansible.legacy.command Invoked with executable=/bin/bash _raw_params=command -v python3 _uses_shell=True zuul_log_id=fa163e3b-3c83-76d0-79de-0000000000ad-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None creates=None removes=None stdin=None Mar 09 20:01:55 np0005642945.novalocal python3[6767]: ansible-ansible.legacy.command Invoked with executable=/bin/bash _raw_params=command -v tox /home/zuul-worker/.local/tox/bin/tox || exit 1 _uses_shell=True zuul_log_id=fa163e3b-3c83-76d0-79de-000000000033-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None creates=None removes=None stdin=None Mar 09 20:01:56 np0005642945.novalocal python3[6795]: ansible-ansible.legacy.command Invoked with _raw_params=/usr/bin/python3 -m venv /home/zuul-worker/.local/tox zuul_log_id=fa163e3b-3c83-76d0-79de-000000000036-1-cloudcentos9stream zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:01:59 np0005642945.novalocal python3[6827]: ansible-ansible.legacy.command Invoked with _raw_params=/home/zuul-worker/.local/tox/bin/pip install tox zuul_log_id=fa163e3b-3c83-76d0-79de-000000000037-1-cloudcentos9stream zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:02:04 np0005642945.novalocal python3[6857]: ansible-ansible.legacy.command Invoked with _raw_params=/home/zuul-worker/.local/tox/bin/tox --version zuul_log_id=fa163e3b-3c83-76d0-79de-00000000003a-1-cloudcentos9stream zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:02:04 np0005642945.novalocal sudo[6884]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-iqnbxlvbkxtedbymcxpjjrpodshotrta ; /usr/bin/python3' Mar 09 20:02:04 np0005642945.novalocal sudo[6884]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:02:04 np0005642945.novalocal python3[6886]: ansible-file Invoked with state=link src=/home/zuul-worker/.local/tox/bin/tox dest=/usr/local/bin/tox path=/usr/local/bin/tox recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:02:04 np0005642945.novalocal sudo[6884]: pam_unix(sudo:session): session closed for user root Mar 09 20:02:05 np0005642945.novalocal python3[6911]: ansible-ansible.legacy.command Invoked with _raw_params=export WBASE="/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo"; mkdir -p $WBASE/playbooks/roles ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-common" $WBASE/playbooks/roles/common; # noqa 204 ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-logs" $WBASE/playbooks/roles/logs; # noqa 204 ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-kolla" $WBASE/playbooks/roles/kolla; # noqa 204 ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-packstack" $WBASE/playbooks/roles/packstack; # noqa 204 ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-puppet-openstack" $WBASE/playbooks/roles/puppet-openstack; # noqa 204 ln -s "/home/zuul-worker/src/github.com/openstack-k8s-operators/ci-framework/roles/build_containers" $WBASE/playbooks/roles/build_containers; # noqa 204 _uses_shell=True zuul_log_id=fa163e3b-3c83-76d0-79de-000000000051-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:02:05 np0005642945.novalocal sudo[6944]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jjsquelkbxzvburcxliujxwvmewdkoln ; /usr/bin/python3' Mar 09 20:02:05 np0005642945.novalocal sudo[6944]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:02:05 np0005642945.novalocal python3[6946]: ansible-file Invoked with path=/etc/ci state=directory owner=root group=root mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:02:05 np0005642945.novalocal sudo[6944]: pam_unix(sudo:session): session closed for user root Mar 09 20:02:06 np0005642945.novalocal sudo[7022]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-aplfecsuyplkqnkkhnhnjlowhpcyzjze ; /usr/bin/python3' Mar 09 20:02:06 np0005642945.novalocal sudo[7022]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:02:06 np0005642945.novalocal python3[7024]: ansible-ansible.legacy.stat Invoked with path=/etc/ci/mirror_info.sh follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Mar 09 20:02:06 np0005642945.novalocal sudo[7022]: pam_unix(sudo:session): session closed for user root Mar 09 20:02:06 np0005642945.novalocal sudo[7095]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vkpmuyiowygnguvmmysjtagkprnhxwez ; /usr/bin/python3' Mar 09 20:02:06 np0005642945.novalocal sudo[7095]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:02:06 np0005642945.novalocal python3[7097]: ansible-ansible.legacy.copy Invoked with dest=/etc/ci/mirror_info.sh owner=root group=root mode=420 src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1773100925.8850567-88-232376766318871/source follow=False _original_basename=mirror_info.sh.j2 checksum=ea5d641d750b2605d80a15d4106dfb6027081c92 backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None seuser=None serole=None selevel=None setype=None attributes=None Mar 09 20:02:06 np0005642945.novalocal sudo[7095]: pam_unix(sudo:session): session closed for user root Mar 09 20:02:07 np0005642945.novalocal sudo[7146]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uhvsrlyaincsiqcggnycdcllsimqewwy ; /usr/bin/python3' Mar 09 20:02:07 np0005642945.novalocal sudo[7146]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:02:07 np0005642945.novalocal python3[7148]: ansible-ansible.legacy.command Invoked with _raw_params=dnf install -y python3-pip rpmlint python3-rpm _uses_shell=True zuul_log_id=fa163e3b-3c83-76d0-79de-000000000064-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:02:07 np0005642945.novalocal sudo[7146]: pam_unix(sudo:session): session closed for user root Mar 09 20:02:08 np0005642945.novalocal python3[7175]: ansible-pip Invoked with name=['rdopkg'] virtualenv=/home/zuul-worker/rdopkg-venv virtualenv_command=/usr/bin/python3 -m venv virtualenv_site_packages=True state=present editable=False version=None requirements=None virtualenv_python=None extra_args=None chdir=None executable=None umask=None Mar 09 20:02:16 np0005642945.novalocal python3[7210]: ansible-ansible.legacy.command Invoked with _raw_params=set -e -x source '/home/zuul-worker/rdopkg-venv/bin/activate' MASTER="$(rdopkg info | grep -e "in development phase" | awk '{print $1}')" RELEASE="antelope" PHASE="release" PROJECT="rdoinfo" DIST_VER="9" case $PROJECT in rdoinfo) REPO="cloud${DIST_VER}-openstack-$RELEASE-$PHASE" ;; nfvinfo) REPO="nfv${DIST_VER}-openvswitch-2-$PHASE" ;; esac # Find out if it is puppet or packstack and scenario if [[ "periodic-cloudsig-antelope-release-puppet-scenario003-centos9" == *"puppet"* ]]; then project="puppet-openstack" elif [[ "periodic-cloudsig-antelope-release-puppet-scenario003-centos9" == *"tcib-container-build"* ]]; then project="tcib-container-build" else project="packstack" fi scenario="scenario003" # Set version related variables if [ $RELEASE = $MASTER ]; then VERSION="master" O_RELEASE="master" else VERSION="$(rdopkg release -r "$RELEASE" | grep upstream_branch | awk '{print $2}')" O_RELEASE="$RELEASE" fi # Prepare Ansible inventory to use localhost pushd /home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo cat <hosts localhost ansible_connection=local ansible_python_interpreter=/usr/bin/python3 [openstack_nodes] localhost log_destination=/var/log/weirdo EOF case $PHASE in testing) REPOS_URL="http://trunk.rdoproject.org/centos9-${O_RELEASE}/puppet-passed-ci/delorean.repo,https://trunk.rdoproject.org/centos9-${O_RELEASE}/delorean-deps.repo" # noqa 204 ADDITIONAL_OPTS="" ;; release) if [ $RELEASE = $MASTER ]; then REPOS_URL="http://trunk.rdoproject.org/centos9-master/puppet-passed-ci/delorean.repo,https://trunk.rdoproject.org/centos9-master/delorean-deps.repo" # noqa 204 ADDITIONAL_OPTS="" else REPOS_URL="$TEMP_REPO_URL" ADDITIONAL_OPTS="-e stable_repositories=centos-release-openstack-${RELEASE} -e testing_repository=false" fi ;; esac tox -e ansible-playbook -- -vv -b -i hosts playbooks/$project-$scenario.yml \ -e version=$VERSION \ -e openstack_release=$O_RELEASE \ -e selinux_enforcing="false" \ -e tempest_from_source=false \ -e enable_puppet_modules_rpm=true \ $ADDITIONAL_OPTS _uses_shell=True zuul_log_id=fa163e3b-3c83-76d0-79de-00000000000d-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:03:28 np0005642945.novalocal sudo[7535]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-caulkmadhqgvaobmgmsfemqmvunilqrs ; /usr/bin/python3' Mar 09 20:03:28 np0005642945.novalocal sudo[7535]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:28 np0005642945.novalocal python3[7537]: ansible-setup Invoked with gather_subset=['all'] gather_timeout=10 filter=* fact_path=/etc/ansible/facts.d Mar 09 20:03:28 np0005642945.novalocal sudo[7535]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:28 np0005642945.novalocal sudo[7575]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qaxkvocivevjnbgfrznkielifreuvjta ; /usr/bin/python3' Mar 09 20:03:28 np0005642945.novalocal sudo[7575]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:29 np0005642945.novalocal python3[7577]: ansible-command Invoked with _raw_params=sudo dnf config-manager --enable crb _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:03:29 np0005642945.novalocal python3[7577]: ansible-command [WARNING] Consider using 'become', 'become_method', and 'become_user' rather than running sudo Mar 09 20:03:29 np0005642945.novalocal sudo[7578]: root : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/dnf config-manager --enable crb Mar 09 20:03:29 np0005642945.novalocal sudo[7578]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:03:29 np0005642945.novalocal sudo[7578]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:29 np0005642945.novalocal sudo[7575]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:29 np0005642945.novalocal sudo[7588]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-amvryxtcwkvvsqqqxcskzjaewovaxoof ; /usr/bin/python3' Mar 09 20:03:29 np0005642945.novalocal sudo[7588]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:29 np0005642945.novalocal python3[7590]: ansible-systemd Invoked with name=firewalld state=stopped daemon_reload=False daemon_reexec=False no_block=False enabled=None force=None masked=None user=None scope=None Mar 09 20:03:29 np0005642945.novalocal sudo[7588]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:30 np0005642945.novalocal sudo[7599]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-suyvavcjhcmcessxccgknbpfdekapyih ; /usr/bin/python3' Mar 09 20:03:30 np0005642945.novalocal sudo[7599]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:30 np0005642945.novalocal python3[7601]: ansible-dnf Invoked with name=['firewalld'] state=absent allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:03:30 np0005642945.novalocal sudo[7599]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:31 np0005642945.novalocal sudo[7617]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jtnfvlvitjecoehghydezsanomjxzkks ; /usr/bin/python3' Mar 09 20:03:31 np0005642945.novalocal sudo[7617]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:31 np0005642945.novalocal python3[7619]: ansible-dnf Invoked with name=['tuned', 'subscription-manager'] state=present allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:03:33 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:03:34 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:03:34 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:03:34 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:03:34 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:03:34 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:03:34 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:03:34 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:03:34 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:03:34 np0005642945.novalocal systemd-rc-local-generator[7692]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:03:34 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:03:36 np0005642945.novalocal sudo[7617]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:36 np0005642945.novalocal sudo[9349]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zrmipxvtqrrxupntdyggtmmtgjeljfep ; /usr/bin/python3' Mar 09 20:03:36 np0005642945.novalocal sudo[9349]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:36 np0005642945.novalocal python3[9371]: ansible-systemd Invoked with name=tuned enabled=True state=started daemon_reload=False daemon_reexec=False no_block=False force=None masked=None user=None scope=None Mar 09 20:03:36 np0005642945.novalocal systemd[1]: Starting Dynamic System Tuning Daemon... Mar 09 20:03:37 np0005642945.novalocal systemd[1]: Starting Authorization Manager... Mar 09 20:03:37 np0005642945.novalocal systemd[1]: Started Dynamic System Tuning Daemon. Mar 09 20:03:37 np0005642945.novalocal sudo[9349]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:37 np0005642945.novalocal polkitd[10321]: Started polkitd version 0.117 Mar 09 20:03:37 np0005642945.novalocal sudo[10480]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oblheiibzqvltmwpidibprjvuqkbjyrz ; /usr/bin/python3' Mar 09 20:03:37 np0005642945.novalocal sudo[10480]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:37 np0005642945.novalocal polkitd[10321]: Loading rules from directory /etc/polkit-1/rules.d Mar 09 20:03:37 np0005642945.novalocal polkitd[10321]: Loading rules from directory /usr/share/polkit-1/rules.d Mar 09 20:03:37 np0005642945.novalocal polkitd[10321]: Finished loading, compiling and executing 2 rules Mar 09 20:03:37 np0005642945.novalocal polkitd[10321]: Acquired the name org.freedesktop.PolicyKit1 on the system bus Mar 09 20:03:37 np0005642945.novalocal systemd[1]: Started Authorization Manager. Mar 09 20:03:37 np0005642945.novalocal python3[10513]: ansible-command Invoked with _raw_params=tuned-adm active warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:03:37 np0005642945.novalocal sudo[10480]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:37 np0005642945.novalocal sudo[10981]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kdqwcopztfberuoiohayyydhahuugfpm ; /usr/bin/python3' Mar 09 20:03:37 np0005642945.novalocal sudo[10981]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:37 np0005642945.novalocal python3[11002]: ansible-command Invoked with _raw_params=tuned-adm profile throughput-performance warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:03:39 np0005642945.novalocal sudo[10981]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:39 np0005642945.novalocal sudo[12147]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yecniadwhgarlyfjrvkhvcmhsebewgak ; /usr/bin/python3' Mar 09 20:03:39 np0005642945.novalocal sudo[12147]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:39 np0005642945.novalocal python3[12164]: ansible-file Invoked with path=/var/log/weirdo state=directory recurse=True force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None content=NOT_LOGGING_PARAMETER backup=None remote_src=None regexp=None delimiter=None directory_mode=None Mar 09 20:03:39 np0005642945.novalocal sudo[12147]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:39 np0005642945.novalocal sudo[12360]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fludlajsdkvxvxhuahuatzqjthiwbztv ; /usr/bin/python3' Mar 09 20:03:39 np0005642945.novalocal sudo[12360]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:39 np0005642945.novalocal python3[12365]: ansible-file Invoked with path=/var/log/weirdo-project state=directory recurse=True force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None content=NOT_LOGGING_PARAMETER backup=None remote_src=None regexp=None delimiter=None directory_mode=None Mar 09 20:03:39 np0005642945.novalocal sudo[12360]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:40 np0005642945.novalocal sudo[12978]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gibgqslskvosrcapqqhowloifkkdluzi ; /usr/bin/python3' Mar 09 20:03:40 np0005642945.novalocal sudo[12978]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:40 np0005642945.novalocal python3[12988]: ansible-dnf Invoked with name=['centos-release-openstack-antelope'] state=present disable_gpg_check=True allow_downgrade=False autoremove=False bugfix=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:03:41 np0005642945.novalocal sudo[12978]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:42 np0005642945.novalocal sudo[14136]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ulhzycsmeohecmdiikzogzuitlrcokaa ; /usr/bin/python3' Mar 09 20:03:42 np0005642945.novalocal sudo[14136]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:42 np0005642945.novalocal python3[14150]: ansible-command Invoked with _raw_params=yum-config-manager --disable rdo-trunk-antelope-tested\* warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:03:42 np0005642945.novalocal sudo[14136]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:42 np0005642945.novalocal sudo[14497]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pwkdbotuklpcirrduwpvotosuaexdgnj ; /usr/bin/python3' Mar 09 20:03:42 np0005642945.novalocal sudo[14497]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:42 np0005642945.novalocal python3[14514]: ansible-command Invoked with _raw_params=IS_CEPH_INSTALLED=$(rpm -qa | grep centos-release-ceph) if [ -n ${IS_CEPH_INSTALLED} ]; then dnf install -y 'dnf-command(config-manager)' dnf config-manager --enable crb dnf install -y epel-release dnf config-manager --disable epel-next dnf config-manager --disable epel-cisco-openh264 dnf config-manager --setopt epel.priority=100 --save epel dnf config-manager --setopt epel.includepkgs="libarrow*,parquet*,python3-asyncssh,re2,python3-grpcio,grpc*,abseil*" --save epel fi _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:03:49 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:03:49 np0005642945.novalocal systemd-rc-local-generator[18256]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:03:49 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:03:51 np0005642945.novalocal sudo[14497]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:51 np0005642945.novalocal sudo[19280]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gzgdqkohfxfelxlybqlubhdbdpmudqty ; /usr/bin/python3' Mar 09 20:03:51 np0005642945.novalocal sudo[19280]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:51 np0005642945.novalocal python3[19293]: ansible-command Invoked with _raw_params=dnf clean all _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:03:51 np0005642945.novalocal python3[19293]: ansible-command [WARNING] Consider using the dnf module rather than running 'dnf'. If you need to use command because dnf is insufficient you can add 'warn: false' to this command task or set 'command_warnings=False' in ansible.cfg to get rid of this message. Mar 09 20:03:52 np0005642945.novalocal sudo[19280]: pam_unix(sudo:session): session closed for user root Mar 09 20:03:52 np0005642945.novalocal sudo[19610]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mzgujdahfcfuovmbeiavpnjhnpysjfgu ; /usr/bin/python3' Mar 09 20:03:52 np0005642945.novalocal sudo[19610]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:03:52 np0005642945.novalocal python3[19623]: ansible-dnf Invoked with name=['*'] state=latest allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:04:02 np0005642945.novalocal systemd[4603]: Starting Mark boot as successful... Mar 09 20:04:02 np0005642945.novalocal systemd[4603]: Finished Mark boot as successful. Mar 09 20:04:08 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:04:08 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:04:08 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Consumed 37.606s CPU time. Mar 09 20:04:08 np0005642945.novalocal systemd[1]: run-r8d66ff97566d44e4b42786db595fcbdf.service: Deactivated successfully. Mar 09 20:04:19 np0005642945.novalocal sudo[19610]: pam_unix(sudo:session): session closed for user root Mar 09 20:04:19 np0005642945.novalocal sudo[28365]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pnojvnmdahrdunidzbfgencunmfrmvus ; /usr/bin/python3' Mar 09 20:04:19 np0005642945.novalocal sudo[28365]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:04:19 np0005642945.novalocal python3[28367]: ansible-dnf Invoked with name=['gettext', 'diffstat', 'doxygen', 'patch', 'patchutils', 'subversion', 'systemtap', 'git', 'wget', 'python3-libselinux', 'python3-setuptools', 'rubygem-rexml'] state=present allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:04:34 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:04:34 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:10 np0005642945.novalocal groupadd[45479]: group added to /etc/group: name=rtkit, GID=172 Mar 09 20:05:10 np0005642945.novalocal groupadd[45479]: group added to /etc/gshadow: name=rtkit Mar 09 20:05:10 np0005642945.novalocal groupadd[45479]: new group: name=rtkit, GID=172 Mar 09 20:05:10 np0005642945.novalocal useradd[45487]: new user: name=rtkit, UID=172, GID=172, home=/, shell=/sbin/nologin, from=none Mar 09 20:05:10 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:10 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:10 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:11 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:11 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:22 np0005642945.novalocal kernel: SELinux: Converting 448 SID table entries... Mar 09 20:05:22 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:05:22 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:05:22 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:05:22 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:05:22 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:05:22 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:05:22 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:05:30 np0005642945.novalocal groupadd[45560]: group added to /etc/group: name=geoclue, GID=994 Mar 09 20:05:30 np0005642945.novalocal groupadd[45560]: group added to /etc/gshadow: name=geoclue Mar 09 20:05:30 np0005642945.novalocal groupadd[45560]: new group: name=geoclue, GID=994 Mar 09 20:05:30 np0005642945.novalocal useradd[45567]: new user: name=geoclue, UID=993, GID=994, home=/var/lib/geoclue, shell=/sbin/nologin, from=none Mar 09 20:05:30 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:30 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=2 res=1 Mar 09 20:05:30 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Reloading rules Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Collecting garbage unconditionally... Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Loading rules from directory /etc/polkit-1/rules.d Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Loading rules from directory /usr/share/polkit-1/rules.d Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Finished loading, compiling and executing 3 rules Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Reloading rules Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Collecting garbage unconditionally... Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Loading rules from directory /etc/polkit-1/rules.d Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Loading rules from directory /usr/share/polkit-1/rules.d Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Finished loading, compiling and executing 3 rules Mar 09 20:05:30 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:30 np0005642945.novalocal groupadd[45579]: group added to /etc/group: name=flatpak, GID=993 Mar 09 20:05:30 np0005642945.novalocal groupadd[45579]: group added to /etc/gshadow: name=flatpak Mar 09 20:05:30 np0005642945.novalocal groupadd[45579]: new group: name=flatpak, GID=993 Mar 09 20:05:30 np0005642945.novalocal useradd[45586]: new user: name=flatpak, UID=992, GID=993, home=/, shell=/usr/sbin/nologin, from=none Mar 09 20:05:30 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:30 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:30 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Reloading rules Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Collecting garbage unconditionally... Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Loading rules from directory /etc/polkit-1/rules.d Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Loading rules from directory /usr/share/polkit-1/rules.d Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Finished loading, compiling and executing 4 rules Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Reloading rules Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Collecting garbage unconditionally... Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Loading rules from directory /etc/polkit-1/rules.d Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Loading rules from directory /usr/share/polkit-1/rules.d Mar 09 20:05:30 np0005642945.novalocal polkitd[10321]: Finished loading, compiling and executing 4 rules Mar 09 20:05:31 np0005642945.novalocal systemd[1]: Stopping OpenSSH server daemon... Mar 09 20:05:31 np0005642945.novalocal sshd[1025]: Received signal 15; terminating. Mar 09 20:05:31 np0005642945.novalocal systemd[1]: sshd.service: Deactivated successfully. Mar 09 20:05:31 np0005642945.novalocal systemd[1]: Stopped OpenSSH server daemon. Mar 09 20:05:31 np0005642945.novalocal systemd[1]: Stopped target sshd-keygen.target. Mar 09 20:05:31 np0005642945.novalocal systemd[1]: Stopping sshd-keygen.target... Mar 09 20:05:31 np0005642945.novalocal systemd[1]: OpenSSH ecdsa Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Mar 09 20:05:31 np0005642945.novalocal systemd[1]: OpenSSH ed25519 Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Mar 09 20:05:31 np0005642945.novalocal systemd[1]: OpenSSH rsa Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Mar 09 20:05:31 np0005642945.novalocal systemd[1]: Reached target sshd-keygen.target. Mar 09 20:05:31 np0005642945.novalocal systemd[1]: Starting OpenSSH server daemon... Mar 09 20:05:31 np0005642945.novalocal sshd[45627]: Server listening on 0.0.0.0 port 22. Mar 09 20:05:31 np0005642945.novalocal sshd[45627]: Server listening on :: port 22. Mar 09 20:05:31 np0005642945.novalocal systemd[1]: Started OpenSSH server daemon. Mar 09 20:05:32 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:05:32 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:05:32 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:05:32 np0005642945.novalocal systemd-rc-local-generator[45727]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:05:32 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:05:35 np0005642945.novalocal sudo[28365]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:35 np0005642945.novalocal sudo[50444]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dqkkniwdhfogarntohvvafpwpvlrrvwc ; /usr/bin/python3' Mar 09 20:05:35 np0005642945.novalocal sudo[50444]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:35 np0005642945.novalocal python3[50466]: ansible-dnf Invoked with name=['net-tools', 'lsof', 'sysstat', 'psmisc', 'dnf-utils'] state=present allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:05:38 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:05:38 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:05:38 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Consumed 7.459s CPU time. Mar 09 20:05:38 np0005642945.novalocal systemd[1]: run-rf925ace0a9a7469b8a0db082b3b37659.service: Deactivated successfully. Mar 09 20:05:40 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:05:40 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:05:40 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:05:40 np0005642945.novalocal systemd-rc-local-generator[54088]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:05:40 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:05:41 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:05:41 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:05:41 np0005642945.novalocal systemd[1]: run-r9c561f8f8425498c9fc0bfaab1193335.service: Deactivated successfully. Mar 09 20:05:41 np0005642945.novalocal sudo[50444]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:41 np0005642945.novalocal sudo[54500]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xnrlrzpknmscnkmkczgqnasjfaybpjin ; /usr/bin/python3' Mar 09 20:05:41 np0005642945.novalocal sudo[54500]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:41 np0005642945.novalocal python3[54502]: ansible-replace Invoked with dest=/usr/lib/systemd/system/sysstat-collect.timer regexp=10 replace=1 path=/usr/lib/systemd/system/sysstat-collect.timer backup=False encoding=utf-8 follow=False unsafe_writes=False after=None before=None validate=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None src=None force=None content=NOT_LOGGING_PARAMETER remote_src=None delimiter=None directory_mode=None Mar 09 20:05:41 np0005642945.novalocal sudo[54500]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:41 np0005642945.novalocal sudo[54510]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-muutrrvxrwjymzbhrqqyaxhqsvqfzbhn ; /usr/bin/python3' Mar 09 20:05:41 np0005642945.novalocal sudo[54510]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:41 np0005642945.novalocal python3[54512]: ansible-systemd Invoked with name=sysstat enabled=True daemon_reload=True state=started daemon_reexec=False no_block=False force=None masked=None user=None scope=None Mar 09 20:05:41 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:05:41 np0005642945.novalocal systemd-rc-local-generator[54535]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:05:42 np0005642945.novalocal systemd[1]: Started Run system activity accounting tool every 1 minutes. Mar 09 20:05:42 np0005642945.novalocal systemd[1]: Started Generate summary of yesterday's process accounting. Mar 09 20:05:42 np0005642945.novalocal systemd[1]: Starting Resets System Activity Logs... Mar 09 20:05:42 np0005642945.novalocal systemd[1]: Finished Resets System Activity Logs. Mar 09 20:05:42 np0005642945.novalocal sudo[54510]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:42 np0005642945.novalocal sudo[54569]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qtkgfssgdekvfzbzlkophlkfrpiqtqkq ; /usr/bin/python3' Mar 09 20:05:42 np0005642945.novalocal sudo[54569]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:42 np0005642945.novalocal python3[54571]: ansible-lineinfile Invoked with dest=/etc/hosts line=127.0.0.1 np0005642945 np0005642945.novalocal state=present path=/etc/hosts backrefs=False create=False backup=False firstmatch=False follow=False unsafe_writes=False regexp=None insertafter=None insertbefore=None validate=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None src=None force=None content=NOT_LOGGING_PARAMETER remote_src=None delimiter=None directory_mode=None Mar 09 20:05:42 np0005642945.novalocal sudo[54569]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:42 np0005642945.novalocal sudo[54578]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jnrbhalkwuerzceoowjcobspxbnoldzo ; /usr/bin/python3' Mar 09 20:05:42 np0005642945.novalocal sudo[54578]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:42 np0005642945.novalocal python3[54580]: ansible-dnf Invoked with name=['libxml2-devel', 'libxslt-devel', 'ruby-devel', 'rubygems', 'qemu-img'] state=latest allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:05:44 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:05:44 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:05:44 np0005642945.novalocal sudo[54578]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:44 np0005642945.novalocal sudo[54910]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wilhfnqxgjuihstzhxsvflnubkuvnfxd ; /usr/bin/python3' Mar 09 20:05:44 np0005642945.novalocal sudo[54910]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:44 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:05:44 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:05:45 np0005642945.novalocal systemd[1]: run-rb9f5688c48394606aaf915c68027597b.service: Deactivated successfully. Mar 09 20:05:45 np0005642945.novalocal python3[54912]: ansible-sysctl [WARNING] The value 0 (type int) in a string field was converted to '0' (type string). If this does not look like what you expect, quote the entire value to ensure it does not change. Mar 09 20:05:45 np0005642945.novalocal python3[54912]: ansible-sysctl Invoked with name=net.ipv6.conf.all.disable_ipv6 value=0 state=present reload=True sysctl_set=False ignoreerrors=False sysctl_file=/etc/sysctl.conf Mar 09 20:05:45 np0005642945.novalocal sudo[54910]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:45 np0005642945.novalocal sudo[54924]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pjdybxppgvdihdxfgdyztzzbupmharvg ; /usr/bin/python3' Mar 09 20:05:45 np0005642945.novalocal sudo[54924]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:45 np0005642945.novalocal python3[54926]: ansible-sysctl [WARNING] The value 0 (type int) in a string field was converted to '0' (type string). If this does not look like what you expect, quote the entire value to ensure it does not change. Mar 09 20:05:45 np0005642945.novalocal python3[54926]: ansible-sysctl Invoked with name=net.ipv6.conf.default.disable_ipv6 value=0 state=present reload=True sysctl_set=False ignoreerrors=False sysctl_file=/etc/sysctl.conf Mar 09 20:05:45 np0005642945.novalocal sudo[54924]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:45 np0005642945.novalocal sudo[54935]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lizdqjrwtfeaaipnofqcyxisohtrikll ; /usr/bin/python3' Mar 09 20:05:45 np0005642945.novalocal sudo[54935]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:45 np0005642945.novalocal python3[54937]: ansible-git Invoked with repo=https://review.opendev.org/openstack/puppet-openstack-integration dest=/tmp/puppet-openstack version=unmaintained/2023.1 force=True remote=origin clone=True update=True verify_commit=False gpg_whitelist=[] accept_hostkey=False bare=False recursive=True track_submodules=False refspec=None reference=None depth=None key_file=None ssh_opts=None executable=None umask=None archive=None separate_git_dir=None Mar 09 20:05:46 np0005642945.novalocal sudo[54935]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:46 np0005642945.novalocal sudo[54969]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lujlllwgyoqxfaaguqriwcfazrdnsbzm ; /usr/bin/python3' Mar 09 20:05:46 np0005642945.novalocal sudo[54969]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:46 np0005642945.novalocal python3[54971]: ansible-file Invoked with path=/tmp/puppet-openstack/.bundled_gems state=directory recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None content=NOT_LOGGING_PARAMETER backup=None remote_src=None regexp=None delimiter=None directory_mode=None Mar 09 20:05:46 np0005642945.novalocal sudo[54969]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:46 np0005642945.novalocal sudo[54978]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-adyuuxivbrsslcfpqtviugqdfieyamik ; /usr/bin/python3' Mar 09 20:05:46 np0005642945.novalocal sudo[54978]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:47 np0005642945.novalocal python3[54980]: ansible-command Invoked with _raw_params=grep ^mod /tmp/puppet-openstack/Puppetfile |egrep -v 'cloudkitty|monasca|apt|python|postgresql|ssh_keygen|git_resource' |awk '{print $2}'|sed "s/[,']//g"|while read p; do printf puppet-$p,; done|sed 's/,$//' _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Mar 09 20:05:47 np0005642945.novalocal sudo[54978]: pam_unix(sudo:session): session closed for user root Mar 09 20:05:47 np0005642945.novalocal sudo[54995]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lflkjypwzwdictfdwladshhozwxctdsh ; /usr/bin/python3' Mar 09 20:05:47 np0005642945.novalocal sudo[54995]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:05:47 np0005642945.novalocal python3[54997]: ansible-dnf Invoked with name=['puppet-aodh', 'puppet-barbican', 'puppet-ceilometer', 'puppet-ceph', 'puppet-cinder', 'puppet-designate', 'puppet-glance', 'puppet-gnocchi', 'puppet-heat', 'puppet-horizon', 'puppet-ironic', 'puppet-keystone', 'puppet-magnum', 'puppet-manila', 'puppet-mistral', 'puppet-neutron', 'puppet-nova', 'puppet-octavia', 'puppet-openstack_extras', 'puppet-openstacklib', 'puppet-oslo', 'puppet-ovn', 'puppet-placement', 'puppet-swift', 'puppet-tempest', 'puppet-trove', 'puppet-vswitch', 'puppet-vitrage', 'puppet-watcher', 'puppet-zaqar', 'puppet-kmod', 'puppet-apache', 'puppet-concat', 'puppet-firewall', 'puppet-inifile', 'puppet-mysql', 'puppet-rabbitmq', 'puppet-rsync', 'puppet-stdlib', 'puppet-vcsrepo', 'puppet-xinetd', 'puppet-memcached', 'puppet-dns', 'puppet-archive', 'puppet-corosync', 'puppet-redis'] state=present allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Mar 09 20:05:53 np0005642945.novalocal groupadd[55069]: group added to /etc/group: name=puppet, GID=52 Mar 09 20:05:53 np0005642945.novalocal groupadd[55069]: group added to /etc/gshadow: name=puppet Mar 09 20:05:53 np0005642945.novalocal groupadd[55069]: new group: name=puppet, GID=52 Mar 09 20:05:53 np0005642945.novalocal useradd[55076]: new user: name=puppet, UID=52, GID=52, home=/var/lib/puppet, shell=/sbin/nologin, from=none Mar 09 20:05:59 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:05:59 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:05:59 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:05:59 np0005642945.novalocal systemd-rc-local-generator[55115]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:05:59 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:06:00 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:06:00 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:06:00 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:06:00 np0005642945.novalocal systemd[1]: run-rd3e9096e79284910a2962e4488e12b77.service: Deactivated successfully. Mar 09 20:06:00 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:06:00 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:06:01 np0005642945.novalocal sudo[54995]: pam_unix(sudo:session): session closed for user root Mar 09 20:06:01 np0005642945.novalocal sudo[55568]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cofywcwiexribethegrqhogiuuguiqth ; /usr/bin/python3' Mar 09 20:06:01 np0005642945.novalocal sudo[55568]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:06:01 np0005642945.novalocal python3[55570]: ansible-file Invoked with path=/etc/puppet/environments state=directory recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None content=NOT_LOGGING_PARAMETER backup=None remote_src=None regexp=None delimiter=None directory_mode=None Mar 09 20:06:01 np0005642945.novalocal sudo[55568]: pam_unix(sudo:session): session closed for user root Mar 09 20:06:01 np0005642945.novalocal sudo[55577]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dmtnbgkirxrfkvhgajykksyryyxjlcsp ; /usr/bin/python3' Mar 09 20:06:01 np0005642945.novalocal sudo[55577]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:06:01 np0005642945.novalocal python3[55579]: ansible-file Invoked with path=/usr/zuul-env/bin/zuul-cloner state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None content=NOT_LOGGING_PARAMETER backup=None remote_src=None regexp=None delimiter=None directory_mode=None Mar 09 20:06:01 np0005642945.novalocal sudo[55577]: pam_unix(sudo:session): session closed for user root Mar 09 20:06:01 np0005642945.novalocal sudo[55586]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fujeuwqqfgcskjxawntsjvwhzgggoymr ; MANAGE_REPOS=false SCENARIO=scenario003 GEM_HOME=/tmp/puppet-openstack/.bundled_gems TEMPEST_VERSION=\'\' WORKSPACE=/var/log/weirdo-project TEMPEST_FROM_SOURCE=false PUPPETFILE_DIR=/etc/puppet/modules PUPPET_PKG=puppet PUPPET_ARGS=--modulepath=/usr/share/openstack-puppet/modules:/etc/puppet/modules SWAP_SIZE_GB=8 /usr/bin/python3' Mar 09 20:06:01 np0005642945.novalocal sudo[55586]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:06:01 np0005642945.novalocal python3[55588]: ansible-command Invoked with chdir=/tmp/puppet-openstack _raw_params=./run_tests.sh warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None executable=None creates=None removes=None stdin=None Mar 09 20:07:02 np0005642945.novalocal systemd[4603]: Created slice User Background Tasks Slice. Mar 09 20:07:02 np0005642945.novalocal systemd[4603]: Starting Cleanup of User's Temporary Files and Directories... Mar 09 20:07:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:07:02 np0005642945.novalocal systemd[4603]: Finished Cleanup of User's Temporary Files and Directories. Mar 09 20:07:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:07:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:07:03 np0005642945.novalocal kernel: Adding 8388604k swap on /swapfile. Priority:-2 extents:5 across:11073180k Mar 09 20:07:31 np0005642945.novalocal kernel: SELinux: Converting 481 SID table entries... Mar 09 20:07:31 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:07:31 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:07:31 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:07:31 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:07:31 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:07:31 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:07:31 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:07:32 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=3 res=1 Mar 09 20:07:32 np0005642945.novalocal systemd[1]: Starting PCP Reboot Initialization Helper Service... Mar 09 20:07:32 np0005642945.novalocal systemd[1]: Finished PCP Reboot Initialization Helper Service. Mar 09 20:07:32 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:07:32 np0005642945.novalocal systemd-rc-local-generator[56284]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:07:36 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:07:36 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:07:42 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:07:42 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:07:43 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:07:43 np0005642945.novalocal systemd-rc-local-generator[56630]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:07:43 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:07:47 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:07:47 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:07:47 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Consumed 4.519s CPU time. Mar 09 20:07:47 np0005642945.novalocal systemd[1]: run-rf55e41fc24ae4d6984ed294f6cf703f9.service: Deactivated successfully. Mar 09 20:08:09 np0005642945.novalocal dbus-broker-launch[798]: avc: op=setenforce lsm=selinux enforcing=0 res=1 Mar 09 20:08:09 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:08:09 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:08:09 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:08:17 np0005642945.novalocal sshd-session[61023]: Connection closed by 167.94.138.198 port 2288 [preauth] Mar 09 20:09:01 np0005642945.novalocal setsebool[62733]: The virt_use_nfs policy boolean was changed to 1 by root Mar 09 20:09:01 np0005642945.novalocal setsebool[62733]: The virt_sandbox_use_all_caps policy boolean was changed to 1 by root Mar 09 20:09:01 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=4 res=1 Mar 09 20:09:01 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:09:01 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:09:01 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:09:11 np0005642945.novalocal kernel: SELinux: Converting 521 SID table entries... Mar 09 20:09:11 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:09:11 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:09:11 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:09:11 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:09:11 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:09:11 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:09:11 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:10:02 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=5 res=1 Mar 09 20:10:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:10:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:10:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:10:08 np0005642945.novalocal kernel: SELinux: Converting 2742 SID table entries... Mar 09 20:10:08 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:10:08 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:10:08 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:10:08 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:10:08 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:10:08 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:10:08 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:10:50 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=7 res=1 Mar 09 20:10:50 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:10:50 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:10:51 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:10:51 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:10:51 np0005642945.novalocal systemd[1]: run-rc520dd9677664f6789d0c2d2377c1cdb.service: Deactivated successfully. Mar 09 20:11:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:11:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:11:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:11:02 np0005642945.novalocal kernel: SELinux: Converting 2742 SID table entries... Mar 09 20:11:02 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:11:02 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:11:02 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:11:02 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:11:02 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:11:02 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:11:02 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:11:02 np0005642945.novalocal groupadd[63814]: group added to /etc/group: name=memcached, GID=989 Mar 09 20:11:02 np0005642945.novalocal groupadd[63814]: group added to /etc/gshadow: name=memcached Mar 09 20:11:02 np0005642945.novalocal groupadd[63814]: new group: name=memcached, GID=989 Mar 09 20:11:02 np0005642945.novalocal useradd[63821]: new user: name=memcached, UID=989, GID=989, home=/, shell=/sbin/nologin, from=none Mar 09 20:11:03 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=8 res=1 Mar 09 20:11:03 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:11:03 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:11:03 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:03 np0005642945.novalocal systemd-rc-local-generator[64254]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:03 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:11:03 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:11:03 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:11:03 np0005642945.novalocal systemd[1]: run-r39cc0b7f3da640fb99f78e63521021e3.service: Deactivated successfully. Mar 09 20:11:04 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:04 np0005642945.novalocal systemd-rc-local-generator[64438]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:04 np0005642945.novalocal systemd[1]: Started memcached daemon. Mar 09 20:11:04 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:04 np0005642945.novalocal systemd-rc-local-generator[64493]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:04 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:04 np0005642945.novalocal systemd-rc-local-generator[64539]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:08 np0005642945.novalocal groupadd[64606]: group added to /etc/group: name=epmd, GID=988 Mar 09 20:11:08 np0005642945.novalocal groupadd[64606]: group added to /etc/gshadow: name=epmd Mar 09 20:11:08 np0005642945.novalocal groupadd[64606]: new group: name=epmd, GID=988 Mar 09 20:11:08 np0005642945.novalocal useradd[64613]: new user: name=epmd, UID=988, GID=988, home=/dev/null, shell=/sbin/nologin, from=none Mar 09 20:11:09 np0005642945.novalocal groupadd[64622]: group added to /etc/group: name=rabbitmq, GID=987 Mar 09 20:11:09 np0005642945.novalocal groupadd[64622]: group added to /etc/gshadow: name=rabbitmq Mar 09 20:11:09 np0005642945.novalocal groupadd[64622]: new group: name=rabbitmq, GID=987 Mar 09 20:11:09 np0005642945.novalocal useradd[64629]: new user: name=rabbitmq, UID=987, GID=987, home=/var/lib/rabbitmq, shell=/sbin/nologin, from=none Mar 09 20:11:10 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:10 np0005642945.novalocal systemd-rc-local-generator[64660]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:11 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:11:11 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:11:11 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:11 np0005642945.novalocal systemd-rc-local-generator[64709]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:11 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:11:12 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:11:12 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:11:12 np0005642945.novalocal systemd[1]: run-rb55ee8bcb9e34dd1857b3dae306600ee.service: Deactivated successfully. Mar 09 20:11:14 np0005642945.novalocal runuser[65504]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:11:14 np0005642945.novalocal runuser[65504]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:11:30 np0005642945.novalocal kernel: SELinux: Converting 2748 SID table entries... Mar 09 20:11:30 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:11:30 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:11:30 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:11:30 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:11:30 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:11:30 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:11:30 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:11:30 np0005642945.novalocal groupadd[66015]: group added to /etc/group: name=mysql, GID=27 Mar 09 20:11:30 np0005642945.novalocal groupadd[66015]: group added to /etc/gshadow: name=mysql Mar 09 20:11:30 np0005642945.novalocal groupadd[66015]: new group: name=mysql, GID=27 Mar 09 20:11:30 np0005642945.novalocal useradd[66021]: new user: name=mysql, UID=27, GID=27, home=/var/lib/mysql, shell=/sbin/nologin, from=none Mar 09 20:11:31 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=9 res=1 Mar 09 20:11:31 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:11:31 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:11:31 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:32 np0005642945.novalocal systemd-rc-local-generator[66499]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:32 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:11:35 np0005642945.novalocal groupadd[69576]: group added to /etc/group: name=redis, GID=986 Mar 09 20:11:35 np0005642945.novalocal groupadd[69576]: group added to /etc/gshadow: name=redis Mar 09 20:11:35 np0005642945.novalocal groupadd[69576]: new group: name=redis, GID=986 Mar 09 20:11:35 np0005642945.novalocal useradd[69639]: new user: name=redis, UID=986, GID=986, home=/var/lib/redis, shell=/sbin/nologin, from=none Mar 09 20:11:35 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:11:35 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:11:35 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Consumed 4.016s CPU time. Mar 09 20:11:35 np0005642945.novalocal systemd[1]: run-rdfbe8697939945308159a111f5deac8c.service: Deactivated successfully. Mar 09 20:11:36 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:11:36 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:11:36 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:36 np0005642945.novalocal systemd-rc-local-generator[69917]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:36 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:11:36 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:11:36 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:11:36 np0005642945.novalocal systemd[1]: run-r76e7852166d94a9997247f4b3d501e76.service: Deactivated successfully. Mar 09 20:11:40 np0005642945.novalocal groupadd[69985]: group added to /etc/group: name=unbound, GID=985 Mar 09 20:11:40 np0005642945.novalocal groupadd[69985]: group added to /etc/gshadow: name=unbound Mar 09 20:11:40 np0005642945.novalocal groupadd[69985]: new group: name=unbound, GID=985 Mar 09 20:11:40 np0005642945.novalocal useradd[69992]: new user: name=unbound, UID=985, GID=985, home=/var/lib/unbound, shell=/sbin/nologin, from=none Mar 09 20:11:40 np0005642945.novalocal systemd[1]: Started daily update of the root trust anchor for DNSSEC. Mar 09 20:11:48 np0005642945.novalocal kernel: SELinux: Converting 2754 SID table entries... Mar 09 20:11:48 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:11:48 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:11:48 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:11:48 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:11:48 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:11:48 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:11:48 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:11:48 np0005642945.novalocal groupadd[70023]: group added to /etc/group: name=openvswitch, GID=984 Mar 09 20:11:48 np0005642945.novalocal groupadd[70023]: group added to /etc/gshadow: name=openvswitch Mar 09 20:11:48 np0005642945.novalocal groupadd[70023]: new group: name=openvswitch, GID=984 Mar 09 20:11:49 np0005642945.novalocal useradd[70030]: new user: name=openvswitch, UID=984, GID=984, home=/, shell=/sbin/nologin, from=none Mar 09 20:11:49 np0005642945.novalocal groupadd[70038]: group added to /etc/group: name=hugetlbfs, GID=983 Mar 09 20:11:49 np0005642945.novalocal groupadd[70038]: group added to /etc/gshadow: name=hugetlbfs Mar 09 20:11:49 np0005642945.novalocal groupadd[70038]: new group: name=hugetlbfs, GID=983 Mar 09 20:11:49 np0005642945.novalocal usermod[70046]: add 'openvswitch' to group 'hugetlbfs' Mar 09 20:11:49 np0005642945.novalocal usermod[70046]: add 'openvswitch' to shadow group 'hugetlbfs' Mar 09 20:11:50 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=10 res=1 Mar 09 20:11:50 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:11:50 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:11:50 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:50 np0005642945.novalocal systemd-rc-local-generator[70519]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:50 np0005642945.novalocal systemd-sysv-generator[70522]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:11:50 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:11:51 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:11:51 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:11:51 np0005642945.novalocal systemd[1]: run-rea2f2d59431b41548de6d74f458ec1c5.service: Deactivated successfully. Mar 09 20:11:51 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:52 np0005642945.novalocal systemd-rc-local-generator[71120]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:52 np0005642945.novalocal systemd-sysv-generator[71123]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:11:52 np0005642945.novalocal systemd[1]: Starting Open vSwitch Database Unit... Mar 09 20:11:52 np0005642945.novalocal chown[71140]: /usr/bin/chown: cannot access '/run/openvswitch': No such file or directory Mar 09 20:11:52 np0005642945.novalocal ovs-ctl[71145]: /etc/openvswitch/conf.db does not exist ... (warning). Mar 09 20:11:52 np0005642945.novalocal ovs-ctl[71145]: Creating empty database /etc/openvswitch/conf.db [ OK ] Mar 09 20:11:52 np0005642945.novalocal ovs-ctl[71145]: Starting ovsdb-server [ OK ] Mar 09 20:11:52 np0005642945.novalocal ovs-vsctl[71194]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --no-wait -- init -- set Open_vSwitch . db-version=8.5.1 Mar 09 20:11:52 np0005642945.novalocal ovs-vsctl[71214]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --no-wait set Open_vSwitch . ovs-version=3.3.5-115.el9s "external-ids:system-id=\"51d01e85-ff8b-453a-92d7-e384e74e3e4c\"" "external-ids:rundir=\"/var/run/openvswitch\"" "system-type=\"centos\"" "system-version=\"9\"" Mar 09 20:11:52 np0005642945.novalocal ovs-ctl[71145]: Configuring Open vSwitch system IDs [ OK ] Mar 09 20:11:52 np0005642945.novalocal ovs-ctl[71145]: Enabling remote OVSDB managers [ OK ] Mar 09 20:11:52 np0005642945.novalocal systemd[1]: Started Open vSwitch Database Unit. Mar 09 20:11:52 np0005642945.novalocal ovs-vsctl[71219]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --no-wait add Open_vSwitch . external-ids hostname=np0005642945 Mar 09 20:11:52 np0005642945.novalocal systemd[1]: Starting Open vSwitch Delete Transient Ports... Mar 09 20:11:52 np0005642945.novalocal systemd[1]: Finished Open vSwitch Delete Transient Ports. Mar 09 20:11:52 np0005642945.novalocal systemd[1]: Starting Open vSwitch Forwarding Unit... Mar 09 20:11:52 np0005642945.novalocal kernel: openvswitch: Open vSwitch switching datapath Mar 09 20:11:52 np0005642945.novalocal ovs-ctl[71265]: Inserting openvswitch module [ OK ] Mar 09 20:11:52 np0005642945.novalocal ovs-ctl[71234]: Starting ovs-vswitchd [ OK ] Mar 09 20:11:52 np0005642945.novalocal ovs-vsctl[71282]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --no-wait add Open_vSwitch . external-ids hostname=np0005642945 Mar 09 20:11:52 np0005642945.novalocal ovs-ctl[71234]: Enabling remote OVSDB managers [ OK ] Mar 09 20:11:52 np0005642945.novalocal systemd[1]: Started Open vSwitch Forwarding Unit. Mar 09 20:11:52 np0005642945.novalocal systemd[1]: Starting Open vSwitch... Mar 09 20:11:52 np0005642945.novalocal systemd[1]: Finished Open vSwitch. Mar 09 20:11:52 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:53 np0005642945.novalocal systemd-rc-local-generator[71307]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:53 np0005642945.novalocal systemd-sysv-generator[71310]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:11:53 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:53 np0005642945.novalocal systemd-sysv-generator[71355]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:11:53 np0005642945.novalocal systemd-rc-local-generator[71352]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:55 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:11:55 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:11:55 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:55 np0005642945.novalocal systemd-sysv-generator[71427]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:11:55 np0005642945.novalocal systemd-rc-local-generator[71424]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:56 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:11:56 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:11:56 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:11:56 np0005642945.novalocal systemd[1]: run-r0289f304d61d4460994dc56c3d537bf7.service: Deactivated successfully. Mar 09 20:11:59 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:11:59 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:11:59 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:11:59 np0005642945.novalocal systemd-rc-local-generator[71874]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:11:59 np0005642945.novalocal systemd-sysv-generator[71877]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:11:59 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:11:59 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:11:59 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:11:59 np0005642945.novalocal systemd[1]: run-r146ac7d913074951b938ff424b234758.service: Deactivated successfully. Mar 09 20:12:00 np0005642945.novalocal ovs-vsctl[71960]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-remote=ssl:[::1]:6642 Mar 09 20:12:00 np0005642945.novalocal ovs-vsctl[71962]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-encap-type=geneve Mar 09 20:12:00 np0005642945.novalocal ovs-vsctl[71964]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-encap-ip=::1 Mar 09 20:12:00 np0005642945.novalocal ovs-vsctl[71967]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:hostname=np0005642945.novalocal Mar 09 20:12:00 np0005642945.novalocal ovs-vsctl[71969]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-bridge=br-int Mar 09 20:12:00 np0005642945.novalocal ovs-vsctl[71971]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-remote-probe-interval=60000 Mar 09 20:12:01 np0005642945.novalocal ovs-vsctl[71973]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-openflow-probe-interval=60 Mar 09 20:12:01 np0005642945.novalocal ovs-vsctl[71975]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-monitor-all=false Mar 09 20:12:01 np0005642945.novalocal ovs-vsctl[71977]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-ofctrl-wait-before-clear=8000 Mar 09 20:12:01 np0005642945.novalocal ovs-vsctl[71979]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-cms-options=enable-chassis-as-gw Mar 09 20:12:01 np0005642945.novalocal ovs-vsctl[71983]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-bridge-mappings=external:br-ex Mar 09 20:12:01 np0005642945.novalocal ovs-vsctl[71987]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl set Open_vSwitch . external_ids:ovn-match-northd-version=false Mar 09 20:12:13 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:12:13 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:12:13 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:12:13 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:12:13 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:12:14 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:12:14 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:12:14 np0005642945.novalocal systemd[1]: run-re96b3c50c1304017bb8a5c5177c39924.service: Deactivated successfully. Mar 09 20:12:25 np0005642945.novalocal groupadd[72298]: group added to /etc/group: name=keystone, GID=163 Mar 09 20:12:25 np0005642945.novalocal groupadd[72298]: group added to /etc/gshadow: name=keystone Mar 09 20:12:25 np0005642945.novalocal groupadd[72298]: new group: name=keystone, GID=163 Mar 09 20:12:25 np0005642945.novalocal useradd[72305]: new user: name=keystone, UID=163, GID=163, home=/var/lib/keystone, shell=/sbin/nologin, from=none Mar 09 20:12:25 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:12:25 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:12:26 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:12:26 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:12:26 np0005642945.novalocal systemd[1]: run-r25186dc7e4ba4f48b4a05723d77e6ef3.service: Deactivated successfully. Mar 09 20:12:28 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:12:28 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:12:29 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:12:29 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:12:29 np0005642945.novalocal systemd[1]: run-r82ac7ad5623b48bb9fd31058c7e96b95.service: Deactivated successfully. Mar 09 20:12:33 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:12:33 np0005642945.novalocal systemd-rc-local-generator[72834]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:12:33 np0005642945.novalocal systemd-sysv-generator[72838]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:12:33 np0005642945.novalocal systemd[1]: Listening on Device-mapper event daemon FIFOs. Mar 09 20:12:33 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:12:33 np0005642945.novalocal systemd-rc-local-generator[72879]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:12:33 np0005642945.novalocal systemd-sysv-generator[72882]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:12:34 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:12:34 np0005642945.novalocal systemd-rc-local-generator[72919]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:12:34 np0005642945.novalocal systemd-sysv-generator[72923]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:12:34 np0005642945.novalocal systemd-logind[828]: Watching system buttons on /dev/input/event0 (Power Button) Mar 09 20:12:34 np0005642945.novalocal systemd-logind[828]: Watching system buttons on /dev/input/event1 (AT Translated Set 2 keyboard) Mar 09 20:12:35 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:12:35 np0005642945.novalocal systemd-sysv-generator[73028]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:12:35 np0005642945.novalocal systemd-rc-local-generator[73025]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:12:35 np0005642945.novalocal systemd[1]: Starting Monitoring of LVM2 mirrors, snapshots etc. using dmeventd or progress polling... Mar 09 20:12:35 np0005642945.novalocal systemd[1]: Finished Monitoring of LVM2 mirrors, snapshots etc. using dmeventd or progress polling. Mar 09 20:12:35 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:12:35 np0005642945.novalocal systemd-sysv-generator[73066]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:12:35 np0005642945.novalocal systemd-rc-local-generator[73062]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:12:35 np0005642945.novalocal systemd[1]: Listening on LVM2 poll daemon socket. Mar 09 20:12:38 np0005642945.novalocal groupadd[73088]: group added to /etc/group: name=glance, GID=161 Mar 09 20:12:38 np0005642945.novalocal groupadd[73088]: group added to /etc/gshadow: name=glance Mar 09 20:12:38 np0005642945.novalocal groupadd[73088]: new group: name=glance, GID=161 Mar 09 20:12:38 np0005642945.novalocal useradd[73095]: new user: name=glance, UID=161, GID=161, home=/var/lib/glance, shell=/sbin/nologin, from=none Mar 09 20:12:38 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:12:38 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:12:38 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:12:38 np0005642945.novalocal systemd-rc-local-generator[73139]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:12:38 np0005642945.novalocal systemd-sysv-generator[73145]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:12:39 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:12:41 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:12:41 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:12:41 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Consumed 2.110s CPU time. Mar 09 20:12:41 np0005642945.novalocal systemd[1]: run-r86e23b37d3d34f4db6a4b0f06fe60596.service: Deactivated successfully. Mar 09 20:12:42 np0005642945.novalocal kernel: SELinux: Converting 2768 SID table entries... Mar 09 20:12:42 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:12:42 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:12:42 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:12:42 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:12:42 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:12:42 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:12:42 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:12:42 np0005642945.novalocal setsebool[75277]: The os_neutron_dac_override policy boolean was changed to on by root Mar 09 20:12:42 np0005642945.novalocal ovs-vsctl[75284]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl add-br br-ex Mar 09 20:12:42 np0005642945.novalocal kernel: ovs-system: entered promiscuous mode Mar 09 20:12:42 np0005642945.novalocal NetworkManager[876]: [1773101562.6650] manager: (ovs-system): 'openvswitch' plugin not available; creating generic device Mar 09 20:12:42 np0005642945.novalocal kernel: Timeout policy base is empty Mar 09 20:12:42 np0005642945.novalocal NetworkManager[876]: [1773101562.6677] manager: (ovs-system): new Generic device (/org/freedesktop/NetworkManager/Devices/3) Mar 09 20:12:42 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=12 res=1 Mar 09 20:12:42 np0005642945.novalocal NetworkManager[876]: [1773101562.7024] manager: (br-ex): 'openvswitch' plugin not available; creating generic device Mar 09 20:12:42 np0005642945.novalocal kernel: br-ex: entered promiscuous mode Mar 09 20:12:42 np0005642945.novalocal NetworkManager[876]: [1773101562.7044] manager: (br-ex): new Generic device (/org/freedesktop/NetworkManager/Devices/4) Mar 09 20:12:42 np0005642945.novalocal systemd-udevd[75300]: Network interface NamePolicy= disabled on kernel command line. Mar 09 20:12:42 np0005642945.novalocal systemd-udevd[75302]: Network interface NamePolicy= disabled on kernel command line. Mar 09 20:12:42 np0005642945.novalocal NetworkManager[876]: [1773101562.7264] device (br-ex): carrier: link connected Mar 09 20:12:42 np0005642945.novalocal NetworkManager[876]: [1773101562.7581] manager: (loop1): new Dummy device (/org/freedesktop/NetworkManager/Devices/5) Mar 09 20:12:42 np0005642945.novalocal ovs-vsctl[75313]: ovs|00001|vsctl|INFO|Called as /bin/ovs-vsctl -- --id=@iface0 create Interface name=loop1 -- add-port br-ex loop1 interfaces=@iface0 Mar 09 20:12:42 np0005642945.novalocal kernel: loop1: entered promiscuous mode Mar 09 20:12:42 np0005642945.novalocal NetworkManager[876]: [1773101562.9259] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75322 uid=0 result="success" Mar 09 20:12:42 np0005642945.novalocal ifdown[75323]: You are using 'ifdown' script provided by 'network-scripts', which are now deprecated. Mar 09 20:12:42 np0005642945.novalocal ifdown[75324]: 'network-scripts' will be removed from distribution in near future. Mar 09 20:12:42 np0005642945.novalocal ifdown[75325]: It is advised to switch to 'NetworkManager' instead - it provides 'ifup/ifdown' scripts as well. Mar 09 20:12:42 np0005642945.novalocal NetworkManager[876]: [1773101562.9566] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75331 uid=0 result="success" Mar 09 20:12:42 np0005642945.novalocal NetworkManager[876]: [1773101562.9977] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75339 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.0233] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75348 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.1252] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75371 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ovs-vsctl[75376]: ovs|00001|vsctl|INFO|Called as ovs-vsctl -t 10 -- --if-exists del-br br-ex Mar 09 20:12:43 np0005642945.novalocal kernel: loop1: left promiscuous mode Mar 09 20:12:43 np0005642945.novalocal kernel: br-ex: left promiscuous mode Mar 09 20:12:43 np0005642945.novalocal kernel: ovs-system: left promiscuous mode Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.2140] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75394 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ifdown[75398]: You are using 'ifdown' script provided by 'network-scripts', which are now deprecated. Mar 09 20:12:43 np0005642945.novalocal ifdown[75399]: 'network-scripts' will be removed from distribution in near future. Mar 09 20:12:43 np0005642945.novalocal ifdown[75400]: It is advised to switch to 'NetworkManager' instead - it provides 'ifup/ifdown' scripts as well. Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.2481] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75406 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.2837] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75417 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.3168] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75429 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.3883] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75455 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ovs-vsctl[75463]: ovs|00001|vsctl|INFO|Called as ovs-vsctl -t 10 -- --if-exists del-port br-ex loop1 Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.4512] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75470 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ifup[75474]: You are using 'ifup' script provided by 'network-scripts', which are now deprecated. Mar 09 20:12:43 np0005642945.novalocal ifup[75475]: 'network-scripts' will be removed from distribution in near future. Mar 09 20:12:43 np0005642945.novalocal ifup[75476]: It is advised to switch to 'NetworkManager' instead - it provides 'ifup/ifdown' scripts as well. Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.4884] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75482 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.5440] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75494 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ifup[75495]: You are using 'ifup' script provided by 'network-scripts', which are now deprecated. Mar 09 20:12:43 np0005642945.novalocal ifup[75496]: 'network-scripts' will be removed from distribution in near future. Mar 09 20:12:43 np0005642945.novalocal ifup[75497]: It is advised to switch to 'NetworkManager' instead - it provides 'ifup/ifdown' scripts as well. Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.5797] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75503 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ovs-vsctl[75505]: ovs|00001|vsctl|INFO|Called as ovs-vsctl -t 10 -- --may-exist add-br br-ex -- set bridge br-ex fail_mode=standalone Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.6087] manager: (ovs-system): 'openvswitch' plugin not available; creating generic device Mar 09 20:12:43 np0005642945.novalocal kernel: ovs-system: entered promiscuous mode Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.6100] manager: (ovs-system): new Generic device (/org/freedesktop/NetworkManager/Devices/6) Mar 09 20:12:43 np0005642945.novalocal kernel: No such timeout policy "ovs_test_tp" Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.6155] manager: (br-ex): 'openvswitch' plugin not available; creating generic device Mar 09 20:12:43 np0005642945.novalocal kernel: br-ex: entered promiscuous mode Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.6168] manager: (br-ex): new Generic device (/org/freedesktop/NetworkManager/Devices/7) Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.6451] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75526 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.6811] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75537 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.7335] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-loop1" pid=75555 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ovs-vsctl[75575]: ovs|00001|vsctl|INFO|Called as ovs-vsctl -t 10 -- --if-exists del-port br-ex loop1 -- add-port br-ex loop1 Mar 09 20:12:43 np0005642945.novalocal kernel: loop1: entered promiscuous mode Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.7862] device (loop1): state change: unmanaged -> unavailable (reason 'connection-assumed', managed-type: 'external') Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.7871] device (loop1): state change: unavailable -> disconnected (reason 'none', managed-type: 'external') Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.8100] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75582 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ifup[75583]: You are using 'ifup' script provided by 'network-scripts', which are now deprecated. Mar 09 20:12:43 np0005642945.novalocal ifup[75584]: 'network-scripts' will be removed from distribution in near future. Mar 09 20:12:43 np0005642945.novalocal ifup[75585]: It is advised to switch to 'NetworkManager' instead - it provides 'ifup/ifdown' scripts as well. Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.8424] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75591 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ovs-vsctl[75595]: ovs|00001|vsctl|INFO|Called as ovs-vsctl -t 10 -- --may-exist add-br br-ex -- set bridge br-ex fail_mode=standalone Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.9114] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75602 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ifup[75603]: You are using 'ifup' script provided by 'network-scripts', which are now deprecated. Mar 09 20:12:43 np0005642945.novalocal ifup[75604]: 'network-scripts' will be removed from distribution in near future. Mar 09 20:12:43 np0005642945.novalocal ifup[75605]: It is advised to switch to 'NetworkManager' instead - it provides 'ifup/ifdown' scripts as well. Mar 09 20:12:43 np0005642945.novalocal NetworkManager[876]: [1773101563.9508] audit: op="connections-load" args="/etc/sysconfig/network-scripts/ifcfg-br-ex" pid=75611 uid=0 result="success" Mar 09 20:12:43 np0005642945.novalocal ovs-vsctl[75615]: ovs|00001|vsctl|INFO|Called as ovs-vsctl -t 10 -- --may-exist add-br br-ex -- set bridge br-ex fail_mode=standalone Mar 09 20:12:44 np0005642945.novalocal NetworkManager[876]: [1773101564.0057] device (br-ex): carrier: link connected Mar 09 20:12:50 np0005642945.novalocal groupadd[75673]: group added to /etc/group: name=radvd, GID=75 Mar 09 20:12:50 np0005642945.novalocal groupadd[75673]: group added to /etc/gshadow: name=radvd Mar 09 20:12:50 np0005642945.novalocal groupadd[75673]: new group: name=radvd, GID=75 Mar 09 20:12:50 np0005642945.novalocal useradd[75682]: new user: name=radvd, UID=75, GID=75, home=/, shell=/sbin/nologin, from=none Mar 09 20:12:50 np0005642945.novalocal groupadd[75697]: group added to /etc/group: name=haproxy, GID=982 Mar 09 20:12:50 np0005642945.novalocal groupadd[75697]: group added to /etc/gshadow: name=haproxy Mar 09 20:12:50 np0005642945.novalocal groupadd[75697]: new group: name=haproxy, GID=982 Mar 09 20:12:50 np0005642945.novalocal useradd[75704]: new user: name=haproxy, UID=983, GID=982, home=/var/lib/haproxy, shell=/usr/sbin/nologin, from=none Mar 09 20:12:51 np0005642945.novalocal groupadd[75716]: group added to /etc/group: name=dnsmasq, GID=981 Mar 09 20:12:51 np0005642945.novalocal groupadd[75716]: group added to /etc/gshadow: name=dnsmasq Mar 09 20:12:51 np0005642945.novalocal groupadd[75716]: new group: name=dnsmasq, GID=981 Mar 09 20:12:51 np0005642945.novalocal useradd[75723]: new user: name=dnsmasq, UID=982, GID=981, home=/var/lib/dnsmasq, shell=/usr/sbin/nologin, from=none Mar 09 20:12:51 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:12:51 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:12:53 np0005642945.novalocal groupadd[75735]: group added to /etc/group: name=neutron, GID=980 Mar 09 20:12:53 np0005642945.novalocal groupadd[75735]: group added to /etc/gshadow: name=neutron Mar 09 20:12:53 np0005642945.novalocal groupadd[75735]: new group: name=neutron, GID=980 Mar 09 20:12:53 np0005642945.novalocal useradd[75742]: new user: name=neutron, UID=981, GID=980, home=/var/lib/neutron, shell=/sbin/nologin, from=none Mar 09 20:12:54 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:12:54 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:12:54 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:12:54 np0005642945.novalocal systemd-rc-local-generator[75798]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:12:54 np0005642945.novalocal systemd-sysv-generator[75801]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:12:54 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:12:55 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:12:55 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:12:55 np0005642945.novalocal systemd[1]: run-r2f4d8517d73c4a02be0c78df4ff0b203.service: Deactivated successfully. Mar 09 20:13:00 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:13:00 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:13:00 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:13:00 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:13:00 np0005642945.novalocal systemd-rc-local-generator[76424]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:13:00 np0005642945.novalocal systemd-sysv-generator[76427]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:13:00 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:13:01 np0005642945.novalocal ovs-vsctl[76447]: ovs|00001|vsctl|INFO|Called as ovs-vsctl set-manager ptcp:6640:127.0.0.1 Mar 09 20:13:05 np0005642945.novalocal groupadd[76466]: group added to /etc/group: name=placement, GID=979 Mar 09 20:13:05 np0005642945.novalocal groupadd[76466]: group added to /etc/gshadow: name=placement Mar 09 20:13:05 np0005642945.novalocal groupadd[76466]: new group: name=placement, GID=979 Mar 09 20:13:05 np0005642945.novalocal useradd[76473]: new user: name=placement, UID=980, GID=979, home=/, shell=/bin/bash, from=none Mar 09 20:13:13 np0005642945.novalocal groupadd[76504]: group added to /etc/group: name=nova, GID=162 Mar 09 20:13:13 np0005642945.novalocal groupadd[76504]: group added to /etc/gshadow: name=nova Mar 09 20:13:13 np0005642945.novalocal groupadd[76504]: new group: name=nova, GID=162 Mar 09 20:13:13 np0005642945.novalocal useradd[76511]: new user: name=nova, UID=162, GID=162, home=/var/lib/nova, shell=/sbin/nologin, from=none Mar 09 20:13:13 np0005642945.novalocal useradd[76511]: add 'nova' to group 'nobody' Mar 09 20:13:13 np0005642945.novalocal useradd[76511]: add 'nova' to group 'nova' Mar 09 20:13:13 np0005642945.novalocal useradd[76511]: add 'nova' to shadow group 'nobody' Mar 09 20:13:13 np0005642945.novalocal useradd[76511]: add 'nova' to shadow group 'nova' Mar 09 20:13:15 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:13:15 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:13:16 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:13:16 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:13:16 np0005642945.novalocal systemd[1]: run-r246e8a7bf2114260b7e1fa090dcca4eb.service: Deactivated successfully. Mar 09 20:13:18 np0005642945.novalocal groupadd[76744]: group added to /etc/group: name=libvirt, GID=978 Mar 09 20:13:18 np0005642945.novalocal groupadd[76744]: group added to /etc/gshadow: name=libvirt Mar 09 20:13:18 np0005642945.novalocal groupadd[76744]: new group: name=libvirt, GID=978 Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Reloading rules Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Collecting garbage unconditionally... Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Loading rules from directory /etc/polkit-1/rules.d Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Loading rules from directory /usr/share/polkit-1/rules.d Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Finished loading, compiling and executing 5 rules Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Reloading rules Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Collecting garbage unconditionally... Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Loading rules from directory /etc/polkit-1/rules.d Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Loading rules from directory /usr/share/polkit-1/rules.d Mar 09 20:13:18 np0005642945.novalocal polkitd[10321]: Finished loading, compiling and executing 5 rules Mar 09 20:13:19 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:13:19 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:13:19 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:13:19 np0005642945.novalocal systemd-rc-local-generator[76872]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:13:19 np0005642945.novalocal systemd-sysv-generator[76875]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:13:19 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:13:20 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:13:20 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:13:20 np0005642945.novalocal systemd[1]: run-re9b71e1ef7be443c887325c46357deb2.service: Deactivated successfully. Mar 09 20:13:34 np0005642945.novalocal kernel: SELinux: Converting 2777 SID table entries... Mar 09 20:13:34 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:13:34 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:13:34 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:13:34 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:13:34 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:13:34 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:13:34 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:13:43 np0005642945.novalocal kernel: SELinux: Converting 2777 SID table entries... Mar 09 20:13:43 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:13:43 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:13:43 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:13:43 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:13:43 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:13:43 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:13:43 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:13:52 np0005642945.novalocal kernel: SELinux: Converting 2777 SID table entries... Mar 09 20:13:52 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:13:52 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:13:52 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:13:52 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:13:52 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:13:52 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:13:52 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:14:01 np0005642945.novalocal kernel: SELinux: Converting 2781 SID table entries... Mar 09 20:14:01 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:14:01 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:14:01 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:14:01 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:14:01 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:14:01 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:14:01 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:14:02 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=16 res=1 Mar 09 20:14:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:14:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:14:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:14:02 np0005642945.novalocal groupadd[77493]: group added to /etc/group: name=qemu, GID=107 Mar 09 20:14:02 np0005642945.novalocal groupadd[77493]: group added to /etc/gshadow: name=qemu Mar 09 20:14:02 np0005642945.novalocal groupadd[77493]: new group: name=qemu, GID=107 Mar 09 20:14:02 np0005642945.novalocal useradd[77500]: new user: name=qemu, UID=107, GID=107, home=/, shell=/sbin/nologin, from=none Mar 09 20:14:02 np0005642945.novalocal useradd[77500]: add 'qemu' to group 'kvm' Mar 09 20:14:02 np0005642945.novalocal useradd[77500]: add 'qemu' to shadow group 'kvm' Mar 09 20:14:03 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:14:03 np0005642945.novalocal dbus-broker-launch[789]: Noticed file-system modification, trigger reload. Mar 09 20:14:06 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:14:06 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:14:06 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:07 np0005642945.novalocal systemd-sysv-generator[78143]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:07 np0005642945.novalocal systemd-rc-local-generator[78138]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:07 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:14:08 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:08 np0005642945.novalocal systemd-sysv-generator[79727]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:08 np0005642945.novalocal systemd-rc-local-generator[79721]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:08 np0005642945.novalocal systemd[1]: One time configuration for iscsi.service was skipped because of an unmet condition check (ConditionPathExists=!/etc/iscsi/initiatorname.iscsi). Mar 09 20:14:08 np0005642945.novalocal systemd[1]: Starting Open-iSCSI... Mar 09 20:14:09 np0005642945.novalocal kernel: Loading iSCSI transport class v2.0-870. Mar 09 20:14:09 np0005642945.novalocal systemd[1]: Started Open-iSCSI. Mar 09 20:14:09 np0005642945.novalocal systemd[1]: Starting Logout off all iSCSI sessions on shutdown... Mar 09 20:14:09 np0005642945.novalocal systemd[1]: Finished Logout off all iSCSI sessions on shutdown. Mar 09 20:14:09 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:09 np0005642945.novalocal systemd-rc-local-generator[80168]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:09 np0005642945.novalocal systemd-sysv-generator[80174]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:09 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:09 np0005642945.novalocal systemd-rc-local-generator[80484]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:09 np0005642945.novalocal systemd-sysv-generator[80491]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:10 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:14:10 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:14:10 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Consumed 3.949s CPU time. Mar 09 20:14:10 np0005642945.novalocal systemd[1]: run-rb77b7e26bbe24339b2c9fdf1ce31c27a.service: Deactivated successfully. Mar 09 20:14:15 np0005642945.novalocal groupadd[81665]: group added to /etc/group: name=trove, GID=977 Mar 09 20:14:15 np0005642945.novalocal groupadd[81665]: group added to /etc/gshadow: name=trove Mar 09 20:14:15 np0005642945.novalocal groupadd[81665]: new group: name=trove, GID=977 Mar 09 20:14:15 np0005642945.novalocal useradd[81672]: new user: name=trove, UID=979, GID=977, home=/var/lib/trove, shell=/sbin/nologin, from=none Mar 09 20:14:15 np0005642945.novalocal useradd[81672]: add 'trove' to group 'trove' Mar 09 20:14:15 np0005642945.novalocal useradd[81672]: add 'trove' to shadow group 'trove' Mar 09 20:14:15 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:14:15 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:14:15 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:16 np0005642945.novalocal systemd-rc-local-generator[81716]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:16 np0005642945.novalocal systemd-sysv-generator[81722]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:16 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:14:16 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:14:16 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:14:16 np0005642945.novalocal systemd[1]: run-r8da8aebfb72b49f59f8c9cc8e839a98e.service: Deactivated successfully. Mar 09 20:14:26 np0005642945.novalocal groupadd[82088]: group added to /etc/group: name=apache, GID=48 Mar 09 20:14:26 np0005642945.novalocal groupadd[82088]: group added to /etc/gshadow: name=apache Mar 09 20:14:26 np0005642945.novalocal groupadd[82088]: new group: name=apache, GID=48 Mar 09 20:14:26 np0005642945.novalocal useradd[82097]: new user: name=apache, UID=48, GID=48, home=/usr/share/httpd, shell=/sbin/nologin, from=none Mar 09 20:14:35 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:35 np0005642945.novalocal systemd-sysv-generator[82135]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:35 np0005642945.novalocal systemd-rc-local-generator[82131]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:36 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:14:36 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:14:36 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:36 np0005642945.novalocal systemd-sysv-generator[82218]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:36 np0005642945.novalocal systemd-rc-local-generator[82214]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:36 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:14:37 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:14:37 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:14:37 np0005642945.novalocal systemd[1]: run-rf1ff43726279480eb06250b25f54ec45.service: Deactivated successfully. Mar 09 20:14:45 np0005642945.novalocal groupadd[82647]: group added to /etc/group: name=heat, GID=187 Mar 09 20:14:45 np0005642945.novalocal groupadd[82647]: group added to /etc/gshadow: name=heat Mar 09 20:14:45 np0005642945.novalocal groupadd[82647]: new group: name=heat, GID=187 Mar 09 20:14:45 np0005642945.novalocal useradd[82654]: new user: name=heat, UID=187, GID=187, home=/var/lib/heat, shell=/sbin/nologin, from=none Mar 09 20:14:46 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:14:46 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:14:47 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:14:47 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:14:47 np0005642945.novalocal systemd[1]: run-rdc87c59e23464b44ade4b532a56484c2.service: Deactivated successfully. Mar 09 20:14:49 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:14:49 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:14:49 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:49 np0005642945.novalocal systemd-sysv-generator[82878]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:49 np0005642945.novalocal systemd-rc-local-generator[82874]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:49 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:14:49 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:14:49 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:14:49 np0005642945.novalocal systemd[1]: run-rae59e108b93d4c8bb91ff2ffa87b3526.service: Deactivated successfully. Mar 09 20:14:51 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:14:51 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:14:51 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:52 np0005642945.novalocal systemd-rc-local-generator[83092]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:52 np0005642945.novalocal systemd-sysv-generator[83095]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:52 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:14:52 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:14:52 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:14:52 np0005642945.novalocal systemd[1]: run-r17671b5932c7481ba4363e9419f38f7f.service: Deactivated successfully. Mar 09 20:14:54 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:14:54 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:14:54 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:14:54 np0005642945.novalocal systemd-rc-local-generator[83307]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:14:54 np0005642945.novalocal systemd-sysv-generator[83310]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:14:54 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:14:54 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:14:54 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:14:55 np0005642945.novalocal systemd[1]: run-r21f40485519b4d6fa6dcfdf07a5e3108.service: Deactivated successfully. Mar 09 20:14:58 np0005642945.novalocal groupadd[83501]: group added to /etc/group: name=named, GID=25 Mar 09 20:14:58 np0005642945.novalocal groupadd[83501]: group added to /etc/gshadow: name=named Mar 09 20:14:58 np0005642945.novalocal groupadd[83501]: new group: name=named, GID=25 Mar 09 20:14:58 np0005642945.novalocal useradd[83509]: new user: name=named, UID=25, GID=25, home=/var/named, shell=/sbin/nologin, from=none Mar 09 20:15:00 np0005642945.novalocal kernel: SELinux: Converting 2792 SID table entries... Mar 09 20:15:00 np0005642945.novalocal kernel: SELinux: policy capability network_peer_controls=1 Mar 09 20:15:00 np0005642945.novalocal kernel: SELinux: policy capability open_perms=1 Mar 09 20:15:00 np0005642945.novalocal kernel: SELinux: policy capability extended_socket_class=1 Mar 09 20:15:00 np0005642945.novalocal kernel: SELinux: policy capability always_check_network=0 Mar 09 20:15:00 np0005642945.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Mar 09 20:15:00 np0005642945.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Mar 09 20:15:00 np0005642945.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Mar 09 20:15:00 np0005642945.novalocal dbus-broker-launch[798]: avc: op=load_policy lsm=selinux seqno=18 res=1 Mar 09 20:15:00 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:15:00 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:15:00 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:15:01 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:15:01 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:15:01 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:01 np0005642945.novalocal systemd-rc-local-generator[83572]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:01 np0005642945.novalocal systemd-sysv-generator[83576]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:01 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:02 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:15:02 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:15:02 np0005642945.novalocal systemd[1]: run-r8527003152c04bc79f912b2f6672343c.service: Deactivated successfully. Mar 09 20:15:05 np0005642945.novalocal groupadd[83989]: group added to /etc/group: name=designate, GID=976 Mar 09 20:15:05 np0005642945.novalocal groupadd[83989]: group added to /etc/gshadow: name=designate Mar 09 20:15:05 np0005642945.novalocal groupadd[83989]: new group: name=designate, GID=976 Mar 09 20:15:05 np0005642945.novalocal useradd[83996]: new user: name=designate, UID=978, GID=976, home=/var/lib/designate, shell=/sbin/nologin, from=none Mar 09 20:15:09 np0005642945.novalocal groupadd[84031]: group added to /etc/group: name=mistral, GID=975 Mar 09 20:15:10 np0005642945.novalocal groupadd[84031]: group added to /etc/gshadow: name=mistral Mar 09 20:15:10 np0005642945.novalocal groupadd[84031]: new group: name=mistral, GID=975 Mar 09 20:15:10 np0005642945.novalocal useradd[84038]: new user: name=mistral, UID=977, GID=975, home=/var/lib/mistral, shell=/sbin/nologin, from=none Mar 09 20:15:10 np0005642945.novalocal useradd[84038]: add 'mistral' to group 'mistral' Mar 09 20:15:10 np0005642945.novalocal useradd[84038]: add 'mistral' to shadow group 'mistral' Mar 09 20:15:10 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:15:10 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:15:11 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:15:11 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:15:11 np0005642945.novalocal systemd[1]: run-rad6a11d023934c668da719e8aecce99c.service: Deactivated successfully. Mar 09 20:15:12 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:13 np0005642945.novalocal systemd-sysv-generator[84253]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:13 np0005642945.novalocal systemd-rc-local-generator[84250]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:13 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:15 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:15 np0005642945.novalocal systemd-rc-local-generator[84301]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:15 np0005642945.novalocal systemd-sysv-generator[84306]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:15 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:18 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:18 np0005642945.novalocal systemd-sysv-generator[84356]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:18 np0005642945.novalocal systemd-rc-local-generator[84352]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:18 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:20 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:20 np0005642945.novalocal systemd-sysv-generator[84410]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:20 np0005642945.novalocal systemd-rc-local-generator[84407]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:21 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:24 np0005642945.novalocal groupadd[84434]: group added to /etc/group: name=barbican, GID=974 Mar 09 20:15:24 np0005642945.novalocal groupadd[84434]: group added to /etc/gshadow: name=barbican Mar 09 20:15:24 np0005642945.novalocal groupadd[84434]: new group: name=barbican, GID=974 Mar 09 20:15:24 np0005642945.novalocal useradd[84441]: new user: name=barbican, UID=976, GID=974, home=/var/lib/barbican, shell=/sbin/nologin, from=none Mar 09 20:15:24 np0005642945.novalocal groupadd[84449]: group added to /etc/group: name=nfast, GID=42481 Mar 09 20:15:24 np0005642945.novalocal groupadd[84449]: group added to /etc/gshadow: name=nfast Mar 09 20:15:24 np0005642945.novalocal groupadd[84449]: new group: name=nfast, GID=42481 Mar 09 20:15:24 np0005642945.novalocal useradd[84456]: new user: name=nfast, UID=42481, GID=42481, home=/home/nfast, shell=/sbin/nologin, from=none Mar 09 20:15:24 np0005642945.novalocal usermod[84463]: add 'barbican' to group 'nfast' Mar 09 20:15:24 np0005642945.novalocal usermod[84463]: add 'barbican' to shadow group 'nfast' Mar 09 20:15:26 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:27 np0005642945.novalocal systemd-rc-local-generator[84503]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:27 np0005642945.novalocal systemd-sysv-generator[84506]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:27 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:27 np0005642945.novalocal systemd-rc-local-generator[84544]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:27 np0005642945.novalocal systemd-sysv-generator[84549]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:27 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:30 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:30 np0005642945.novalocal systemd-rc-local-generator[84598]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:30 np0005642945.novalocal systemd-sysv-generator[84603]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:31 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:31 np0005642945.novalocal systemd-rc-local-generator[84640]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:31 np0005642945.novalocal systemd-sysv-generator[84643]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:31 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:33 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:33 np0005642945.novalocal systemd-rc-local-generator[84693]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:33 np0005642945.novalocal systemd-sysv-generator[84699]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:34 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:34 np0005642945.novalocal systemd-sysv-generator[84733]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:34 np0005642945.novalocal systemd-rc-local-generator[84729]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:34 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:36 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:36 np0005642945.novalocal systemd-sysv-generator[84785]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:36 np0005642945.novalocal systemd-rc-local-generator[84781]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:36 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:37 np0005642945.novalocal systemd-sysv-generator[84828]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:37 np0005642945.novalocal systemd-rc-local-generator[84823]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:37 np0005642945.novalocal systemd[1]: Starting dnf makecache... Mar 09 20:15:37 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:37 np0005642945.novalocal dnf[84841]: Updating Subscription Management repositories. Mar 09 20:15:37 np0005642945.novalocal dnf[84841]: Unable to read consumer identity Mar 09 20:15:37 np0005642945.novalocal dnf[84841]: This system is not registered with an entitlement server. You can use subscription-manager to register. Mar 09 20:15:37 np0005642945.novalocal dnf[84841]: Failed determining last makecache time. Mar 09 20:15:37 np0005642945.novalocal dnf[84841]: CentOS-9-stream - Ceph Quincy 99 kB/s | 11 kB 00:00 Mar 09 20:15:37 np0005642945.novalocal dnf[84841]: CentOS-9 - RabbitMQ 38 33 kB/s | 8.0 kB 00:00 Mar 09 20:15:37 np0005642945.novalocal dnf[84841]: CentOS Stream 9 - NFV OpenvSwitch 69 kB/s | 7.5 kB 00:00 Mar 09 20:15:38 np0005642945.novalocal dnf[84841]: CentOS-9 - OpenStack antelope 79 kB/s | 8.1 kB 00:00 Mar 09 20:15:38 np0005642945.novalocal dnf[84841]: CentOS Stream 9 - BaseOS 383 kB/s | 3.9 kB 00:00 Mar 09 20:15:38 np0005642945.novalocal dnf[84841]: CentOS Stream 9 - AppStream 1.0 MB/s | 4.4 kB 00:00 Mar 09 20:15:38 np0005642945.novalocal dnf[84841]: CentOS Stream 9 - CRB 951 kB/s | 4.3 kB 00:00 Mar 09 20:15:38 np0005642945.novalocal dnf[84841]: CentOS Stream 9 - Extras packages 884 kB/s | 3.0 kB 00:00 Mar 09 20:15:38 np0005642945.novalocal dnf[84841]: Metadata cache created. Mar 09 20:15:38 np0005642945.novalocal systemd[1]: dnf-makecache.service: Deactivated successfully. Mar 09 20:15:38 np0005642945.novalocal systemd[1]: Finished dnf makecache. Mar 09 20:15:40 np0005642945.novalocal groupadd[84860]: group added to /etc/group: name=magnum, GID=1870 Mar 09 20:15:40 np0005642945.novalocal groupadd[84860]: group added to /etc/gshadow: name=magnum Mar 09 20:15:40 np0005642945.novalocal groupadd[84860]: new group: name=magnum, GID=1870 Mar 09 20:15:40 np0005642945.novalocal useradd[84867]: new user: name=magnum, UID=1870, GID=1870, home=/var/lib/magnum, shell=/sbin/nologin, from=none Mar 09 20:15:43 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:43 np0005642945.novalocal systemd-sysv-generator[84915]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:43 np0005642945.novalocal systemd-rc-local-generator[84911]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:43 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:15:46 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:15:46 np0005642945.novalocal systemd-sysv-generator[84968]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:15:46 np0005642945.novalocal systemd-rc-local-generator[84965]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:15:46 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:16:01 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:16:01 np0005642945.novalocal systemd[1]: Starting Cleanup of Temporary Directories... Mar 09 20:16:01 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:16:01 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:16:01 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:16:01 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:16:01 np0005642945.novalocal systemd[1]: systemd-tmpfiles-clean.service: Deactivated successfully. Mar 09 20:16:01 np0005642945.novalocal systemd[1]: Finished Cleanup of Temporary Directories. Mar 09 20:16:01 np0005642945.novalocal systemd[1]: run-credentials-systemd\x2dtmpfiles\x2dclean.service.mount: Deactivated successfully. Mar 09 20:16:01 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:16:01 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:16:01 np0005642945.novalocal systemd[1]: run-rca67d2a0863b45fdb4b0979e6983b8fb.service: Deactivated successfully. Mar 09 20:16:14 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:14 np0005642945.novalocal systemd-rc-local-generator[85328]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:14 np0005642945.novalocal systemd-sysv-generator[85333]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:14 np0005642945.novalocal systemd[1]: Starting MariaDB 10.5 database server... Mar 09 20:16:14 np0005642945.novalocal mariadb-prepare-db-dir[85369]: Database MariaDB is probably initialized in /var/lib/mysql already, nothing is done. Mar 09 20:16:14 np0005642945.novalocal mariadb-prepare-db-dir[85369]: If this is not the case, make sure the /var/lib/mysql is empty before running mariadb-prepare-db-dir. Mar 09 20:16:14 np0005642945.novalocal systemd[1]: Started MariaDB 10.5 database server. Mar 09 20:16:14 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:15 np0005642945.novalocal systemd-rc-local-generator[85488]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:15 np0005642945.novalocal systemd-sysv-generator[85492]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:15 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:15 np0005642945.novalocal systemd-sysv-generator[85526]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:15 np0005642945.novalocal systemd-rc-local-generator[85523]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:15 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:15 np0005642945.novalocal systemd-rc-local-generator[85568]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:15 np0005642945.novalocal systemd-sysv-generator[85572]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:16 np0005642945.novalocal systemd[1]: Starting Redis persistent key-value database... Mar 09 20:16:16 np0005642945.novalocal systemd[1]: Started Redis persistent key-value database. Mar 09 20:16:16 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:16 np0005642945.novalocal systemd-rc-local-generator[85616]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:16 np0005642945.novalocal systemd-sysv-generator[85619]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:16 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:16 np0005642945.novalocal systemd-rc-local-generator[85652]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:16 np0005642945.novalocal systemd-sysv-generator[85658]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:17 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:17 np0005642945.novalocal systemd-sysv-generator[85746]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:17 np0005642945.novalocal systemd-rc-local-generator[85743]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:17 np0005642945.novalocal systemd[1]: Starting OVN northd management daemon... Mar 09 20:16:17 np0005642945.novalocal chown[85762]: /usr/bin/chown: cannot access '/var/lib/ovn': No such file or directory Mar 09 20:16:17 np0005642945.novalocal ovn-ctl[85763]: /var/lib/ovn/ovnnb_db.db does not exist ... (warning). Mar 09 20:16:17 np0005642945.novalocal ovn-ctl[85763]: Creating empty database /var/lib/ovn/ovnnb_db.db [ OK ] Mar 09 20:16:17 np0005642945.novalocal ovsdb-server[85865]: ovs|00001|vlog|INFO|opened log file /var/log/ovn/ovsdb-server-nb.log Mar 09 20:16:17 np0005642945.novalocal ovsdb-server[85867]: ovs|00002|ovsdb_server|INFO|ovsdb-server (Open vSwitch) 3.3.5-115.el9s Mar 09 20:16:17 np0005642945.novalocal ovsdb-server[85866]: ovs|00002|vlog(monitor)|INFO|closing log file Mar 09 20:16:17 np0005642945.novalocal ovsdb-server[85866]: ovs|00003|vlog(monitor)|INFO|opened log file (null) Mar 09 20:16:17 np0005642945.novalocal ovn-ctl[85763]: Starting ovsdb-nb [ OK ] Mar 09 20:16:17 np0005642945.novalocal ovn-nbctl[85871]: ovs|00001|ovn_dbctl|INFO|Called as ovn-nbctl --no-leader-only --db=unix:/run/ovn/ovnnb_db.sock init Mar 09 20:16:17 np0005642945.novalocal ovn-ctl[85763]: /var/lib/ovn/ovnsb_db.db does not exist ... (warning). Mar 09 20:16:17 np0005642945.novalocal ovn-ctl[85763]: Creating empty database /var/lib/ovn/ovnsb_db.db [ OK ] Mar 09 20:16:17 np0005642945.novalocal ovsdb-server[85891]: ovs|00001|vlog|INFO|opened log file /var/log/ovn/ovsdb-server-sb.log Mar 09 20:16:18 np0005642945.novalocal ovsdb-server[85893]: ovs|00002|ovsdb_server|INFO|ovsdb-server (Open vSwitch) 3.3.5-115.el9s Mar 09 20:16:18 np0005642945.novalocal ovsdb-server[85892]: ovs|00002|vlog(monitor)|INFO|closing log file Mar 09 20:16:18 np0005642945.novalocal ovsdb-server[85892]: ovs|00003|vlog(monitor)|INFO|opened log file (null) Mar 09 20:16:18 np0005642945.novalocal ovn-ctl[85763]: Starting ovsdb-sb [ OK ] Mar 09 20:16:18 np0005642945.novalocal ovn-sbctl[85897]: ovs|00001|ovn_dbctl|INFO|Called as ovn-sbctl --no-leader-only --db=unix:/run/ovn/ovnsb_db.sock init Mar 09 20:16:18 np0005642945.novalocal ovn-ctl[85763]: Starting ovn-northd [ OK ] Mar 09 20:16:18 np0005642945.novalocal systemd[1]: Finished OVN northd management daemon. Mar 09 20:16:18 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:18 np0005642945.novalocal systemd-rc-local-generator[85935]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:18 np0005642945.novalocal systemd-sysv-generator[85940]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:18 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:18 np0005642945.novalocal systemd-rc-local-generator[85975]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:18 np0005642945.novalocal systemd-sysv-generator[85980]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:18 np0005642945.novalocal ovn-nbctl[85995]: ovs|00001|ovn_dbctl|INFO|Called as ovn-nbctl set-connection pssl:6641:[::1] Mar 09 20:16:18 np0005642945.novalocal ovn-sbctl[85999]: ovs|00001|ovn_dbctl|INFO|Called as ovn-sbctl set-connection pssl:6642:[::1] Mar 09 20:16:19 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:19 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:19 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:19 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:19 np0005642945.novalocal systemd-rc-local-generator[86049]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:19 np0005642945.novalocal systemd-sysv-generator[86053]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:19 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:19 np0005642945.novalocal systemd[1]: Starting OVN controller daemon... Mar 09 20:16:19 np0005642945.novalocal ovn-ctl[86067]: Starting ovn-controller [ OK ] Mar 09 20:16:19 np0005642945.novalocal systemd[1]: Started OVN controller daemon. Mar 09 20:16:19 np0005642945.novalocal kernel: br-int: entered promiscuous mode Mar 09 20:16:19 np0005642945.novalocal NetworkManager[876]: [1773101779.7011] manager: (br-int): 'openvswitch' plugin not available; creating generic device Mar 09 20:16:19 np0005642945.novalocal NetworkManager[876]: [1773101779.7031] manager: (br-int): new Generic device (/org/freedesktop/NetworkManager/Devices/8) Mar 09 20:16:19 np0005642945.novalocal systemd-udevd[86124]: Network interface NamePolicy= disabled on kernel command line. Mar 09 20:16:19 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:19 np0005642945.novalocal systemd-rc-local-generator[86149]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:19 np0005642945.novalocal systemd-sysv-generator[86154]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:19 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:20 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:20 np0005642945.novalocal systemd-sysv-generator[86189]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:20 np0005642945.novalocal systemd-rc-local-generator[86186]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:20 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:27 np0005642945.novalocal ovsdb-server[85867]: ovs|00003|memory|INFO|10380 kB peak resident set size after 10.1 seconds Mar 09 20:16:27 np0005642945.novalocal ovsdb-server[85867]: ovs|00004|memory|INFO|atoms:43 cells:43 json-caches:1 monitors:2 n-weak-refs:0 sessions:1 Mar 09 20:16:27 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:28 np0005642945.novalocal ovsdb-server[85893]: ovs|00003|memory|INFO|10952 kB peak resident set size after 10.0 seconds Mar 09 20:16:28 np0005642945.novalocal ovsdb-server[85893]: ovs|00004|memory|INFO|atoms:447 cells:355 json-caches:1 monitors:3 n-weak-refs:11 sessions:2 Mar 09 20:16:28 np0005642945.novalocal systemd-sysv-generator[86250]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:28 np0005642945.novalocal systemd-rc-local-generator[86246]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:28 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:28 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:16:30 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:30 np0005642945.novalocal systemd-rc-local-generator[86296]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:30 np0005642945.novalocal systemd-sysv-generator[86300]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:30 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:30 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:16:35 np0005642945.novalocal groupadd[86361]: group added to /etc/group: name=clevis, GID=973 Mar 09 20:16:35 np0005642945.novalocal groupadd[86361]: group added to /etc/gshadow: name=clevis Mar 09 20:16:35 np0005642945.novalocal groupadd[86361]: new group: name=clevis, GID=973 Mar 09 20:16:35 np0005642945.novalocal useradd[86368]: new user: name=clevis, UID=975, GID=973, home=/var/cache/clevis, shell=/usr/sbin/nologin, from=none Mar 09 20:16:35 np0005642945.novalocal usermod[86378]: add 'clevis' to group 'tss' Mar 09 20:16:35 np0005642945.novalocal usermod[86378]: add 'clevis' to shadow group 'tss' Mar 09 20:16:35 np0005642945.novalocal usermod[86394]: add 'nova' to group 'qemu' Mar 09 20:16:35 np0005642945.novalocal usermod[86394]: add 'nova' to shadow group 'qemu' Mar 09 20:16:35 np0005642945.novalocal usermod[86401]: add 'nova' to group 'libvirt' Mar 09 20:16:35 np0005642945.novalocal usermod[86401]: add 'nova' to shadow group 'libvirt' Mar 09 20:16:36 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:16:36 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:16:36 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:36 np0005642945.novalocal systemd-rc-local-generator[86476]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:36 np0005642945.novalocal systemd-sysv-generator[86480]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:36 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:36 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:16:39 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:39 np0005642945.novalocal systemd-rc-local-generator[88942]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:39 np0005642945.novalocal systemd-sysv-generator[88945]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:40 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:40 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:16:41 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:16:41 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:16:41 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Consumed 5.156s CPU time. Mar 09 20:16:41 np0005642945.novalocal systemd[1]: run-r981504c20dbc4229bd1b4dbbca084f1b.service: Deactivated successfully. Mar 09 20:16:43 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:16:43 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:16:43 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:43 np0005642945.novalocal systemd-sysv-generator[90464]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:43 np0005642945.novalocal systemd-rc-local-generator[90457]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:43 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:43 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:16:43 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:16:43 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:16:43 np0005642945.novalocal systemd[1]: run-r5a80d4952c6c479a9cff4f73721c70a0.service: Deactivated successfully. Mar 09 20:16:46 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:46 np0005642945.novalocal systemd-sysv-generator[90659]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:46 np0005642945.novalocal systemd-rc-local-generator[90656]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:46 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:51 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:52 np0005642945.novalocal systemd-sysv-generator[90714]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:52 np0005642945.novalocal systemd-rc-local-generator[90710]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:52 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:52 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:16:56 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:56 np0005642945.novalocal systemd-rc-local-generator[90757]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:56 np0005642945.novalocal systemd-sysv-generator[90762]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:56 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:56 np0005642945.novalocal systemd[1]: Starting Generate rndc key for BIND (DNS)... Mar 09 20:16:56 np0005642945.novalocal systemd[1]: named-setup-rndc.service: Deactivated successfully. Mar 09 20:16:56 np0005642945.novalocal systemd[1]: Finished Generate rndc key for BIND (DNS). Mar 09 20:16:56 np0005642945.novalocal systemd[1]: Starting Berkeley Internet Name Domain (DNS)... Mar 09 20:16:56 np0005642945.novalocal bash[90781]: zone localhost.localdomain/IN: loaded serial 0 Mar 09 20:16:56 np0005642945.novalocal bash[90781]: zone localhost/IN: loaded serial 0 Mar 09 20:16:56 np0005642945.novalocal bash[90781]: zone 1.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.ip6.arpa/IN: loaded serial 0 Mar 09 20:16:56 np0005642945.novalocal bash[90781]: zone 1.0.0.127.in-addr.arpa/IN: loaded serial 0 Mar 09 20:16:56 np0005642945.novalocal bash[90781]: zone 0.in-addr.arpa/IN: loaded serial 0 Mar 09 20:16:57 np0005642945.novalocal named[90783]: starting BIND 9.16.23-RH (Extended Support Version) Mar 09 20:16:57 np0005642945.novalocal named[90783]: running on Linux x86_64 5.14.0-687.el9.x86_64 #1 SMP PREEMPT_DYNAMIC Mon Feb 23 11:11:46 UTC 2026 Mar 09 20:16:57 np0005642945.novalocal named[90783]: built with '--build=x86_64-redhat-linux-gnu' '--host=x86_64-redhat-linux-gnu' '--program-prefix=' '--disable-dependency-tracking' '--prefix=/usr' '--exec-prefix=/usr' '--bindir=/usr/bin' '--sbindir=/usr/sbin' '--sysconfdir=/etc' '--datadir=/usr/share' '--includedir=/usr/include' '--libdir=/usr/lib64' '--libexecdir=/usr/libexec' '--sharedstatedir=/var/lib' '--mandir=/usr/share/man' '--infodir=/usr/share/info' '--with-python=/usr/bin/python3' '--with-libtool' '--localstatedir=/var' '--with-pic' '--disable-static' '--includedir=/usr/include/bind9' '--with-tuning=large' '--with-libidn2' '--with-maxminddb' '--with-dlopen=yes' '--with-gssapi=yes' '--with-lmdb=yes' '--without-libjson' '--with-json-c' '--enable-dnstap' '--enable-fixed-rrset' '--enable-full-report' 'build_alias=x86_64-redhat-linux-gnu' 'host_alias=x86_64-redhat-linux-gnu' 'CC=gcc' 'CFLAGS= -O2 -flto=auto -ffat-lto-objects -fexceptions -g -grecord-gcc-switches -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -fstack-protector-strong -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=x86-64-v2 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protection' 'LDFLAGS=-Wl,-z,relro -Wl,--as-needed -Wl,-z,now -specs=/usr/lib/rpm/redhat/redhat-hardened-ld -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 ' 'LT_SYS_LIBRARY_PATH=/usr/lib64:' 'PKG_CONFIG_PATH=:/usr/lib64/pkgconfig:/usr/share/pkgconfig' Mar 09 20:16:57 np0005642945.novalocal named[90783]: running as: named -u named -c /etc/named.conf Mar 09 20:16:57 np0005642945.novalocal named[90783]: compiled by GCC 11.5.0 20240719 (Red Hat 11.5.0-14) Mar 09 20:16:57 np0005642945.novalocal named[90783]: compiled with OpenSSL version: OpenSSL 3.5.1 1 Jul 2025 Mar 09 20:16:57 np0005642945.novalocal named[90783]: linked to OpenSSL version: OpenSSL 3.5.5 27 Jan 2026 Mar 09 20:16:57 np0005642945.novalocal named[90783]: compiled with libxml2 version: 2.9.13 Mar 09 20:16:57 np0005642945.novalocal named[90783]: linked to libxml2 version: 20913 Mar 09 20:16:57 np0005642945.novalocal named[90783]: compiled with json-c version: 0.14 Mar 09 20:16:57 np0005642945.novalocal named[90783]: linked to json-c version: 0.14 Mar 09 20:16:57 np0005642945.novalocal named[90783]: compiled with zlib version: 1.2.11 Mar 09 20:16:57 np0005642945.novalocal named[90783]: linked to zlib version: 1.2.11 Mar 09 20:16:57 np0005642945.novalocal named[90783]: ---------------------------------------------------- Mar 09 20:16:57 np0005642945.novalocal named[90783]: BIND 9 is maintained by Internet Systems Consortium, Mar 09 20:16:57 np0005642945.novalocal named[90783]: Inc. (ISC), a non-profit 501(c)(3) public-benefit Mar 09 20:16:57 np0005642945.novalocal named[90783]: corporation. Support and training for BIND 9 are Mar 09 20:16:57 np0005642945.novalocal named[90783]: available at https://www.isc.org/support Mar 09 20:16:57 np0005642945.novalocal named[90783]: ---------------------------------------------------- Mar 09 20:16:57 np0005642945.novalocal named[90783]: adjusted limit on open files from 524288 to 1048576 Mar 09 20:16:57 np0005642945.novalocal named[90783]: found 8 CPUs, using 8 worker threads Mar 09 20:16:57 np0005642945.novalocal named[90783]: using 8 UDP listeners per interface Mar 09 20:16:57 np0005642945.novalocal named[90783]: using up to 21000 sockets Mar 09 20:16:57 np0005642945.novalocal named[90783]: loading configuration from '/etc/named.conf' Mar 09 20:16:57 np0005642945.novalocal named[90783]: unable to open '/etc/bind.keys'; using built-in keys instead Mar 09 20:16:57 np0005642945.novalocal named[90783]: looking for GeoIP2 databases in '/usr/share/GeoIP' Mar 09 20:16:57 np0005642945.novalocal named[90783]: opened GeoIP2 database '/usr/share/GeoIP/GeoLite2-Country.mmdb' Mar 09 20:16:57 np0005642945.novalocal named[90783]: opened GeoIP2 database '/usr/share/GeoIP/GeoLite2-City.mmdb' Mar 09 20:16:57 np0005642945.novalocal named[90783]: using default UDP/IPv4 port range: [32768, 60999] Mar 09 20:16:57 np0005642945.novalocal named[90783]: using default UDP/IPv6 port range: [32768, 60999] Mar 09 20:16:57 np0005642945.novalocal named[90783]: listening on IPv6 interface lo, ::1#5322 Mar 09 20:16:57 np0005642945.novalocal named[90783]: generating session key for dynamic DNS Mar 09 20:16:57 np0005642945.novalocal named[90783]: loading NZD zone count from '_default.nzd' for view '_default' Mar 09 20:16:57 np0005642945.novalocal named[90783]: NZD database '_default.nzd' contains 0 zones Mar 09 20:16:57 np0005642945.novalocal named[90783]: sizing zone task pool based on 5 zones Mar 09 20:16:57 np0005642945.novalocal named[90783]: loading NZD configs from '_default.nzd' for view '_default' Mar 09 20:16:57 np0005642945.novalocal named[90783]: set up managed keys zone for view _default, file 'managed-keys.bind' Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 10.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 16.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 17.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 18.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 19.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 20.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 21.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 22.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 23.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 24.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 25.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 26.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 27.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 28.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 29.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 30.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 31.172.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 168.192.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 64.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 65.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 66.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 67.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 68.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 69.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 70.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 71.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 72.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 73.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 74.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 75.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 76.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 77.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 78.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 79.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 80.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 81.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 82.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 83.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 84.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 85.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 86.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 87.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 88.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 89.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 90.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 91.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 92.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 93.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 94.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 95.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 96.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 97.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 98.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 99.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 100.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 101.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 102.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 103.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 104.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 105.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 106.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 107.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 108.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 109.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 110.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 111.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 112.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 113.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 114.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 115.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 116.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 117.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 118.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 119.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 120.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 121.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 122.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 123.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 124.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 125.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 126.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 127.100.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 127.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 254.169.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 2.0.192.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 100.51.198.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 113.0.203.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 255.255.255.255.IN-ADDR.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.IP6.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: D.F.IP6.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 8.E.F.IP6.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 9.E.F.IP6.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: A.E.F.IP6.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: B.E.F.IP6.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: 8.B.D.0.1.0.0.2.IP6.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: EMPTY.AS112.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: automatic empty zone: HOME.ARPA Mar 09 20:16:57 np0005642945.novalocal named[90783]: command channel listening on ::1#953 Mar 09 20:16:57 np0005642945.novalocal named[90783]: managed-keys-zone: loaded serial 0 Mar 09 20:16:57 np0005642945.novalocal named[90783]: zone 0.in-addr.arpa/IN: loaded serial 0 Mar 09 20:16:57 np0005642945.novalocal named[90783]: zone localhost.localdomain/IN: loaded serial 0 Mar 09 20:16:57 np0005642945.novalocal named[90783]: zone 1.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.ip6.arpa/IN: loaded serial 0 Mar 09 20:16:57 np0005642945.novalocal named[90783]: zone 1.0.0.127.in-addr.arpa/IN: loaded serial 0 Mar 09 20:16:57 np0005642945.novalocal named[90783]: zone localhost/IN: loaded serial 0 Mar 09 20:16:57 np0005642945.novalocal named[90783]: all zones loaded Mar 09 20:16:57 np0005642945.novalocal named[90783]: running Mar 09 20:16:57 np0005642945.novalocal systemd[1]: Started Berkeley Internet Name Domain (DNS). Mar 09 20:16:57 np0005642945.novalocal systemd[1]: Reached target Host and Network Name Lookups. Mar 09 20:16:57 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:57 np0005642945.novalocal systemd-sysv-generator[90834]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:57 np0005642945.novalocal systemd-rc-local-generator[90830]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:57 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:16:57 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:16:57 np0005642945.novalocal systemd-sysv-generator[90873]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:16:57 np0005642945.novalocal systemd-rc-local-generator[90869]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:16:57 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:17:00 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:17:00 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:17:00 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:17:00 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:17:00 np0005642945.novalocal systemd-sysv-generator[90926]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:17:00 np0005642945.novalocal systemd-rc-local-generator[90923]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:17:00 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:17:00 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:17:03 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:17:03 np0005642945.novalocal systemd-rc-local-generator[90975]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:17:03 np0005642945.novalocal systemd-sysv-generator[90978]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:17:03 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:17:03 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:17:05 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:17:06 np0005642945.novalocal systemd-rc-local-generator[91026]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:17:06 np0005642945.novalocal systemd-sysv-generator[91029]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:17:06 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:17:06 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:17:08 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:17:08 np0005642945.novalocal systemd-sysv-generator[91085]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:17:08 np0005642945.novalocal systemd-rc-local-generator[91080]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:17:08 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:17:09 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:17:11 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:17:11 np0005642945.novalocal systemd-rc-local-generator[91132]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:17:11 np0005642945.novalocal systemd-sysv-generator[91135]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:17:11 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:17:12 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:17:30 np0005642945.novalocal crontab[91205]: (root) LIST (root) Mar 09 20:17:30 np0005642945.novalocal crontab[91206]: (root) LIST (keystone) Mar 09 20:17:30 np0005642945.novalocal crontab[91207]: (root) LIST (glance) Mar 09 20:17:30 np0005642945.novalocal crontab[91208]: (root) LIST (nova) Mar 09 20:17:30 np0005642945.novalocal crontab[91209]: (root) LIST (heat) Mar 09 20:17:30 np0005642945.novalocal crontab[91210]: (root) REPLACE (glance) Mar 09 20:17:42 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:17:42 np0005642945.novalocal systemd-rc-local-generator[91264]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:17:42 np0005642945.novalocal systemd-sysv-generator[91267]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:17:42 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:17:42 np0005642945.novalocal systemd[1]: Listening on libvirt legacy monolithic daemon socket. Mar 09 20:17:42 np0005642945.novalocal systemd[1]: Listening on libvirt legacy monolithic daemon non-TLS IP socket. Mar 09 20:17:42 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:17:43 np0005642945.novalocal systemd-rc-local-generator[91300]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:17:43 np0005642945.novalocal systemd-sysv-generator[91303]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:17:43 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:17:43 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:17:43 np0005642945.novalocal systemd-rc-local-generator[91339]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:17:43 np0005642945.novalocal systemd-sysv-generator[91344]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:17:43 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:18:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:18:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:18:03 np0005642945.novalocal crontab[91393]: (root) REPLACE (nova) Mar 09 20:18:08 np0005642945.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Mar 09 20:18:08 np0005642945.novalocal systemd[1]: Starting man-db-cache-update.service... Mar 09 20:18:08 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:08 np0005642945.novalocal systemd-rc-local-generator[91437]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:08 np0005642945.novalocal systemd-sysv-generator[91440]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:08 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:09 np0005642945.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Mar 09 20:18:09 np0005642945.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Mar 09 20:18:09 np0005642945.novalocal systemd[1]: Finished man-db-cache-update.service. Mar 09 20:18:09 np0005642945.novalocal systemd[1]: run-r36dc4b7435f3420984fc888d78e50c5c.service: Deactivated successfully. Mar 09 20:18:12 np0005642945.novalocal crontab[91556]: (root) REPLACE (heat) Mar 09 20:18:29 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:29 np0005642945.novalocal systemd-rc-local-generator[91616]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:29 np0005642945.novalocal systemd-sysv-generator[91619]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:29 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:29 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:30 np0005642945.novalocal systemd-rc-local-generator[91662]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:30 np0005642945.novalocal systemd-sysv-generator[91665]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:30 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:30 np0005642945.novalocal systemd[91677]: epmd.socket: Failed to create listening socket ([::]:4369): Address already in use Mar 09 20:18:30 np0005642945.novalocal systemd[1]: epmd.socket: Failed to receive listening socket ([::]:4369): Input/output error Mar 09 20:18:30 np0005642945.novalocal systemd[1]: epmd.socket: Failed to listen on sockets: Input/output error Mar 09 20:18:30 np0005642945.novalocal systemd[1]: epmd.socket: Failed with result 'resources'. Mar 09 20:18:30 np0005642945.novalocal systemd[1]: Failed to listen on Erlang Port Mapper Daemon Activation Socket. Mar 09 20:18:30 np0005642945.novalocal systemd[1]: Starting RabbitMQ broker... Mar 09 20:18:30 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:30.882703-04:00 [warning] <0.129.0> Both old (.config) and new (.conf) format config files exist. Mar 09 20:18:30 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:30.896189-04:00 [warning] <0.129.0> Using the old format config file: /etc/rabbitmq/rabbitmq.config Mar 09 20:18:30 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:30.896235-04:00 [warning] <0.129.0> Please update your config files to the new format and remove the old file. Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.083804-04:00 [info] <0.229.0> Feature flags: list of feature flags found: Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.083891-04:00 [info] <0.229.0> Feature flags: [ ] implicit_default_bindings Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.083911-04:00 [info] <0.229.0> Feature flags: [ ] maintenance_mode_status Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.083936-04:00 [info] <0.229.0> Feature flags: [ ] quorum_queue Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.083995-04:00 [info] <0.229.0> Feature flags: [ ] stream_queue Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.084009-04:00 [info] <0.229.0> Feature flags: [ ] user_limits Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.084024-04:00 [info] <0.229.0> Feature flags: [ ] virtual_host_metadata Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.084068-04:00 [info] <0.229.0> Feature flags: feature flag states written to disk: yes Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.306027-04:00 [notice] <0.44.0> Application syslog exited with reason: stopped Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: 2026-03-09 20:18:32.306131-04:00 [notice] <0.229.0> Logging: switching to configured handler(s); following messages may not be visible in this log output Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: ## ## RabbitMQ 3.9.21 Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: ## ## Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: ########## Copyright (c) 2007-2022 VMware, Inc. or its affiliates. Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: ###### ## Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: ########## Licensed under the MPL 2.0. Website: https://rabbitmq.com Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: Erlang: 24.3.4.2 [jit] Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: TLS Library: OpenSSL - OpenSSL 3.5.5 27 Jan 2026 Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: Doc guides: https://rabbitmq.com/documentation.html Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: Support: https://rabbitmq.com/contact.html Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: Tutorials: https://rabbitmq.com/getstarted.html Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: Monitoring: https://rabbitmq.com/monitoring.html Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: Logs: /var/log/rabbitmq/rabbit@localhost6.log Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: /var/log/rabbitmq/rabbit@localhost6_upgrade.log Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: Mar 09 20:18:32 np0005642945.novalocal rabbitmq-server[91678]: Config file(s): /etc/rabbitmq/rabbitmq.config Mar 09 20:18:34 np0005642945.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Mar 09 20:18:35 np0005642945.novalocal rabbitmq-server[91678]: Starting broker... completed with 3 plugins. Mar 09 20:18:35 np0005642945.novalocal systemd[1]: Started RabbitMQ broker. Mar 09 20:18:35 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:35 np0005642945.novalocal systemd-rc-local-generator[91782]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:35 np0005642945.novalocal systemd-sysv-generator[91786]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:35 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:35 np0005642945.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Mar 09 20:18:35 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:35 np0005642945.novalocal systemd-rc-local-generator[91826]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:35 np0005642945.novalocal systemd-sysv-generator[91829]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:35 np0005642945.novalocal setroubleshoot[91761]: failed to retrieve rpm info for path '/proc/net/if_inet6': Mar 09 20:18:35 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:35 np0005642945.novalocal systemd[1]: Created slice Slice /system/dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged. Mar 09 20:18:35 np0005642945.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@0.service. Mar 09 20:18:35 np0005642945.novalocal runuser[91851]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:36 np0005642945.novalocal runuser[91851]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:36 np0005642945.novalocal runuser[91907]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:37 np0005642945.novalocal setroubleshoot[91761]: SELinux is preventing /usr/lib64/erlang/erts-12.3.2.2/bin/inet_gethost from read access on the lnk_file /proc/net/if_inet6. For complete SELinux messages run: sealert -l 3c74bac1-8f60-40a9-96ff-d490907232d1 Mar 09 20:18:37 np0005642945.novalocal setroubleshoot[91761]: SELinux is preventing /usr/lib64/erlang/erts-12.3.2.2/bin/inet_gethost from read access on the lnk_file /proc/net/if_inet6. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that inet_gethost should be allowed read access on the if_inet6 lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'inet_gethost' --raw | audit2allow -M my-inetgethost # semodule -X 300 -i my-inetgethost.pp Mar 09 20:18:37 np0005642945.novalocal runuser[91907]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:37 np0005642945.novalocal runuser[91960]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:37 np0005642945.novalocal runuser[91960]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:37 np0005642945.novalocal runuser[92014]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:38 np0005642945.novalocal runuser[92014]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:38 np0005642945.novalocal runuser[92068]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:39 np0005642945.novalocal runuser[92068]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:39 np0005642945.novalocal runuser[92120]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:39 np0005642945.novalocal runuser[92120]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:39 np0005642945.novalocal runuser[92172]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:40 np0005642945.novalocal runuser[92172]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:40 np0005642945.novalocal runuser[92224]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:40 np0005642945.novalocal runuser[92224]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:41 np0005642945.novalocal runuser[92278]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:41 np0005642945.novalocal runuser[92278]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:41 np0005642945.novalocal runuser[92330]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:42 np0005642945.novalocal runuser[92330]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:42 np0005642945.novalocal runuser[92382]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:42 np0005642945.novalocal runuser[92382]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:42 np0005642945.novalocal runuser[92434]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:43 np0005642945.novalocal runuser[92434]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:43 np0005642945.novalocal runuser[92486]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:44 np0005642945.novalocal runuser[92486]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:44 np0005642945.novalocal runuser[92538]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:44 np0005642945.novalocal runuser[92538]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:45 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:45 np0005642945.novalocal systemd-sysv-generator[92619]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:45 np0005642945.novalocal systemd-rc-local-generator[92615]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:45 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:45 np0005642945.novalocal systemd[1]: Started OpenStack Image Service (code-named Glance) API server. Mar 09 20:18:45 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:45 np0005642945.novalocal systemd-rc-local-generator[92660]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:45 np0005642945.novalocal systemd-sysv-generator[92665]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:45 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:46 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:46 np0005642945.novalocal systemd-rc-local-generator[92696]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:46 np0005642945.novalocal systemd-sysv-generator[92700]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:46 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:46 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@0.service: Deactivated successfully. Mar 09 20:18:46 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@0.service: Consumed 1.124s CPU time. Mar 09 20:18:46 np0005642945.novalocal runuser[92715]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:47 np0005642945.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Mar 09 20:18:47 np0005642945.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Mar 09 20:18:47 np0005642945.novalocal runuser[92715]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:47 np0005642945.novalocal runuser[92769]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:47 np0005642945.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Mar 09 20:18:47 np0005642945.novalocal runuser[92769]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:47 np0005642945.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@1.service. Mar 09 20:18:47 np0005642945.novalocal runuser[92834]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:48 np0005642945.novalocal runuser[92834]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:48 np0005642945.novalocal runuser[92888]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. For complete SELinux messages run: sealert -l cb0399d7-8c52-4627-9a86-3ce97ed1cfa9 Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the hostname file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. For complete SELinux messages run: sealert -l 6f32a08a-e1a7-413a-8ea4-f7f0d0f2b5fc Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the rpm file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. For complete SELinux messages run: sealert -l 64f6178d-9516-4ac6-8026-e660f40824eb Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the gpg file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 70e72618-d831-4f29-8758-81756234f3da Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. For complete SELinux messages run: sealert -l 51722b80-92ea-4ba6-b347-ead6cb4a550d Mar 09 20:18:48 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the dnf-utils file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. For complete SELinux messages run: sealert -l 4aabea47-0e61-4295-8cb2-af408bc08fb2 Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the traceroute file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. For complete SELinux messages run: sealert -l 7952b88f-e656-4a77-9d45-fa2bec3adb02 Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the consolehelper file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-upgrade. For complete SELinux messages run: sealert -l 32180127-2c8e-4ce6-9fcc-19cd4cbec17b Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-upgrade. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadb-upgrade file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/redis-server. For complete SELinux messages run: sealert -l 23319e62-39fc-4ff7-a589-8f9239b106b1 Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/redis-server. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the redis-server file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. For complete SELinux messages run: sealert -l 6db3ccc6-4929-4ef7-a384-32f94d7b8286 Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadbd-safe file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. For complete SELinux messages run: sealert -l 4e6690c6-4bfc-4801-b52b-7089120bb21c Mar 09 20:18:49 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the keepalived file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Mar 09 20:18:49 np0005642945.novalocal runuser[92888]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:49 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:49 np0005642945.novalocal systemd-rc-local-generator[92975]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:49 np0005642945.novalocal systemd-sysv-generator[92979]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:49 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:49 np0005642945.novalocal systemd[1]: Starting OpenStack Neutron Server... Mar 09 20:18:51 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 69c3e109-32dd-444c-b34d-9f529e79a13b Mar 09 20:18:51 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Mar 09 20:18:52 np0005642945.novalocal systemd[1]: Started OpenStack Neutron Server. Mar 09 20:18:52 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:53 np0005642945.novalocal systemd-rc-local-generator[93034]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:53 np0005642945.novalocal systemd-sysv-generator[93038]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:53 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:53 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:53 np0005642945.novalocal systemd-rc-local-generator[93073]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:53 np0005642945.novalocal systemd-sysv-generator[93076]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:53 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:53 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:54 np0005642945.novalocal systemd-rc-local-generator[93112]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:54 np0005642945.novalocal systemd-sysv-generator[93115]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:54 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:54 np0005642945.novalocal systemd[1]: Started OpenStack Neutron OVN Metadata Agent. Mar 09 20:18:54 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:54 np0005642945.novalocal systemd-rc-local-generator[93157]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:54 np0005642945.novalocal systemd-sysv-generator[93160]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:54 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:54 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:55 np0005642945.novalocal systemd-rc-local-generator[93197]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:55 np0005642945.novalocal systemd-sysv-generator[93201]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:55 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:55 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 69c3e109-32dd-444c-b34d-9f529e79a13b Mar 09 20:18:55 np0005642945.novalocal setroubleshoot[92768]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Mar 09 20:18:55 np0005642945.novalocal runuser[93216]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:55 np0005642945.novalocal runuser[93216]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:55 np0005642945.novalocal runuser[93269]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:56 np0005642945.novalocal runuser[93269]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:56 np0005642945.novalocal runuser[93322]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:56 np0005642945.novalocal sudo[93367]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap /etc/neutron/rootwrap.conf privsep-helper --config-file /etc/neutron/neutron_ovn_metadata_agent.ini --config-dir /etc/neutron/conf.d/neutron-ovn-metadata-agent --privsep_context neutron.privileged.namespace_cmd --privsep_sock_path /tmp/tmpcutonw37/privsep.sock Mar 09 20:18:56 np0005642945.novalocal systemd[1]: Created slice User Slice of UID 0. Mar 09 20:18:56 np0005642945.novalocal systemd[1]: Starting User Runtime Directory /run/user/0... Mar 09 20:18:56 np0005642945.novalocal systemd[1]: Finished User Runtime Directory /run/user/0. Mar 09 20:18:56 np0005642945.novalocal systemd[1]: Starting User Manager for UID 0... Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: pam_unix(systemd-user:session): session opened for user root(uid=0) by root(uid=0) Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Queued start job for default target Main User Target. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Created slice User Application Slice. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Mark boot as successful after the user session has run 2 minutes was skipped because of an unmet condition check (ConditionUser=!@system). Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Started Daily Cleanup of User's Temporary Directories. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Reached target Paths. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Reached target Timers. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Starting D-Bus User Message Bus Socket... Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: PipeWire PulseAudio was skipped because of an unmet condition check (ConditionUser=!root). Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: PipeWire Multimedia System Sockets was skipped because of an unmet condition check (ConditionUser=!root). Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Starting Create User's Volatile Files and Directories... Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Listening on D-Bus User Message Bus Socket. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Reached target Sockets. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Finished Create User's Volatile Files and Directories. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Reached target Basic System. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Reached target Main User Target. Mar 09 20:18:56 np0005642945.novalocal systemd[93370]: Startup finished in 126ms. Mar 09 20:18:56 np0005642945.novalocal systemd[1]: Started User Manager for UID 0. Mar 09 20:18:57 np0005642945.novalocal systemd[1]: Started Session c1 of User root. Mar 09 20:18:57 np0005642945.novalocal sudo[93367]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=981) Mar 09 20:18:57 np0005642945.novalocal runuser[93322]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:57 np0005642945.novalocal runuser[93386]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:18:57 np0005642945.novalocal kernel: capability: warning: `privsep-helper' uses deprecated v2 capabilities in a way that may be insecure Mar 09 20:18:57 np0005642945.novalocal sudo[93367]: pam_unix(sudo:session): session closed for user root Mar 09 20:18:57 np0005642945.novalocal runuser[93386]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:18:58 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:58 np0005642945.novalocal systemd-rc-local-generator[93470]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:58 np0005642945.novalocal systemd-sysv-generator[93477]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:58 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:58 np0005642945.novalocal systemd[1]: Listening on libvirt locking daemon socket. Mar 09 20:18:58 np0005642945.novalocal systemd[1]: Listening on libvirt locking daemon admin socket. Mar 09 20:18:58 np0005642945.novalocal systemd[1]: Starting libvirt locking daemon... Mar 09 20:18:58 np0005642945.novalocal systemd[1]: Started libvirt locking daemon. Mar 09 20:18:58 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:58 np0005642945.novalocal systemd-rc-local-generator[93516]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:58 np0005642945.novalocal systemd-sysv-generator[93519]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:58 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:58 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:59 np0005642945.novalocal systemd-sysv-generator[93554]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:59 np0005642945.novalocal systemd-rc-local-generator[93549]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:59 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:59 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:18:59 np0005642945.novalocal systemd-sysv-generator[93596]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:18:59 np0005642945.novalocal systemd-rc-local-generator[93593]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:18:59 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:18:59 np0005642945.novalocal systemd[1]: Listening on libvirt logging daemon socket. Mar 09 20:18:59 np0005642945.novalocal systemd[1]: Listening on libvirt logging daemon admin socket. Mar 09 20:18:59 np0005642945.novalocal systemd[1]: Starting libvirt logging daemon... Mar 09 20:18:59 np0005642945.novalocal systemd[1]: Started libvirt logging daemon. Mar 09 20:18:59 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:00 np0005642945.novalocal systemd-rc-local-generator[93635]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:00 np0005642945.novalocal systemd-sysv-generator[93640]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:00 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:00 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:19:00 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:19:00 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:19:00 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:00 np0005642945.novalocal systemd-rc-local-generator[93672]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:00 np0005642945.novalocal systemd-sysv-generator[93675]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:00 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:00 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:01 np0005642945.novalocal systemd-rc-local-generator[93721]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:01 np0005642945.novalocal systemd-sysv-generator[93724]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:01 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:01 np0005642945.novalocal systemd[1]: Created slice Virtual Machine and Container Slice. Mar 09 20:19:01 np0005642945.novalocal systemd[1]: Listening on libvirt legacy monolithic daemon admin socket. Mar 09 20:19:01 np0005642945.novalocal systemd[1]: Listening on libvirt legacy monolithic daemon read-only socket. Mar 09 20:19:01 np0005642945.novalocal systemd[1]: Virtual Machine and Container Storage (Compatibility) was skipped because of an unmet condition check (ConditionPathExists=/var/lib/machines.raw). Mar 09 20:19:01 np0005642945.novalocal systemd[1]: Starting Virtual Machine and Container Registration Service... Mar 09 20:19:01 np0005642945.novalocal systemd[1]: Started Virtual Machine and Container Registration Service. Mar 09 20:19:01 np0005642945.novalocal systemd[1]: Starting libvirt legacy monolithic daemon... Mar 09 20:19:01 np0005642945.novalocal systemd[1]: Started libvirt legacy monolithic daemon. Mar 09 20:19:01 np0005642945.novalocal kernel: bridge: filtering via arp/ip/ip6tables is no longer available by default. Update your scripts to load br_netfilter if you need this. Mar 09 20:19:01 np0005642945.novalocal NetworkManager[876]: [1773101941.8139] manager: (virbr0): new Bridge device (/org/freedesktop/NetworkManager/Devices/9) Mar 09 20:19:01 np0005642945.novalocal systemd-udevd[93757]: Network interface NamePolicy= disabled on kernel command line. Mar 09 20:19:01 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:02 np0005642945.novalocal systemd-rc-local-generator[93814]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:02 np0005642945.novalocal systemd-sysv-generator[93819]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:02 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.1564] device (virbr0): state change: unmanaged -> unavailable (reason 'connection-assumed', managed-type: 'external') Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.1577] device (virbr0): state change: unavailable -> disconnected (reason 'connection-assumed', managed-type: 'external') Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.1587] device (virbr0): Activation: starting connection 'virbr0' (4a74b6de-a943-498f-922a-eb4154f25b5f) Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.1588] device (virbr0): state change: disconnected -> prepare (reason 'none', managed-type: 'external') Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.1593] device (virbr0): state change: prepare -> config (reason 'none', managed-type: 'external') Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.1596] device (virbr0): state change: config -> ip-config (reason 'none', managed-type: 'external') Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.1600] device (virbr0): state change: ip-config -> ip-check (reason 'none', managed-type: 'external') Mar 09 20:19:02 np0005642945.novalocal systemd[1]: Starting Network Manager Script Dispatcher Service... Mar 09 20:19:02 np0005642945.novalocal dnsmasq[93866]: started, version 2.85 cachesize 150 Mar 09 20:19:02 np0005642945.novalocal dnsmasq[93866]: compile time options: IPv6 GNU-getopt DBus no-UBus no-i18n IDN2 DHCP DHCPv6 no-Lua TFTP no-conntrack ipset auth cryptohash DNSSEC loop-detect inotify dumpfile Mar 09 20:19:02 np0005642945.novalocal dnsmasq-dhcp[93866]: DHCP, IP range 192.168.122.2 -- 192.168.122.254, lease time 1h Mar 09 20:19:02 np0005642945.novalocal dnsmasq-dhcp[93866]: DHCP, sockets bound exclusively to interface virbr0 Mar 09 20:19:02 np0005642945.novalocal dnsmasq[93866]: reading /etc/resolv.conf Mar 09 20:19:02 np0005642945.novalocal dnsmasq[93866]: using nameserver 199.204.44.24#53 Mar 09 20:19:02 np0005642945.novalocal dnsmasq[93866]: using nameserver 199.204.47.54#53 Mar 09 20:19:02 np0005642945.novalocal dnsmasq[93866]: read /etc/hosts - 3 addresses Mar 09 20:19:02 np0005642945.novalocal dnsmasq[93866]: read /var/lib/libvirt/dnsmasq/default.addnhosts - 0 addresses Mar 09 20:19:02 np0005642945.novalocal dnsmasq-dhcp[93866]: read /var/lib/libvirt/dnsmasq/default.hostsfile Mar 09 20:19:02 np0005642945.novalocal systemd[1]: Started Network Manager Script Dispatcher Service. Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.2078] device (virbr0): state change: ip-check -> secondaries (reason 'none', managed-type: 'external') Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.2083] device (virbr0): state change: secondaries -> activated (reason 'none', managed-type: 'external') Mar 09 20:19:02 np0005642945.novalocal NetworkManager[876]: [1773101942.2092] device (virbr0): Activation: successful, device activated. Mar 09 20:19:02 np0005642945.novalocal systemd[1]: iscsi.service: Unit cannot be reloaded because it is inactive. Mar 09 20:19:02 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:02 np0005642945.novalocal systemd-rc-local-generator[93907]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:02 np0005642945.novalocal systemd-sysv-generator[93910]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:02 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:03 np0005642945.novalocal dnsmasq[93866]: exiting on receipt of SIGTERM Mar 09 20:19:03 np0005642945.novalocal NetworkManager[876]: [1773101943.3224] device (virbr0): state change: activated -> unmanaged (reason 'unmanaged-external-down', managed-type: 'external') Mar 09 20:19:04 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:04 np0005642945.novalocal systemd-rc-local-generator[94005]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:04 np0005642945.novalocal systemd-sysv-generator[94008]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:04 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:04 np0005642945.novalocal systemd[1]: Started OpenStack Nova NoVNC Proxy Server. Mar 09 20:19:04 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:05 np0005642945.novalocal systemd-rc-local-generator[94047]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:05 np0005642945.novalocal systemd-sysv-generator[94051]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:05 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:05 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:05 np0005642945.novalocal systemd-sysv-generator[94094]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:05 np0005642945.novalocal systemd-rc-local-generator[94091]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:05 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:05 np0005642945.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Mar 09 20:19:05 np0005642945.novalocal systemd[1]: setroubleshootd.service: Consumed 1.316s CPU time. Mar 09 20:19:05 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@1.service: Deactivated successfully. Mar 09 20:19:05 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@1.service: Consumed 1.125s CPU time. Mar 09 20:19:05 np0005642945.novalocal runuser[94106]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:06 np0005642945.novalocal runuser[94106]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:06 np0005642945.novalocal runuser[94159]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:07 np0005642945.novalocal runuser[94159]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:07 np0005642945.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Mar 09 20:19:07 np0005642945.novalocal runuser[94213]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:07 np0005642945.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Mar 09 20:19:07 np0005642945.novalocal runuser[94213]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:07 np0005642945.novalocal runuser[94268]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:07 np0005642945.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@2.service. Mar 09 20:19:08 np0005642945.novalocal runuser[94268]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:08 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:08 np0005642945.novalocal systemd-rc-local-generator[94364]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:09 np0005642945.novalocal systemd-sysv-generator[94369]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:09 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:09 np0005642945.novalocal systemd[1]: Started OpenStack Trove Conductor Service. Mar 09 20:19:09 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:09 np0005642945.novalocal systemd-rc-local-generator[94397]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. For complete SELinux messages run: sealert -l 69867177-a959-4242-aeac-944fdd481302 Mar 09 20:19:09 np0005642945.novalocal systemd-sysv-generator[94400]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the hostname file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:09 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. For complete SELinux messages run: sealert -l da7baf01-d2b7-4f2c-9790-25af599c9011 Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the rpm file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. For complete SELinux messages run: sealert -l 4bb12bf8-8af6-4967-98d0-e8f710ad410d Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the gpg file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b20a522-0da0-4b6a-a041-b36356dfd5ce Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:09 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. For complete SELinux messages run: sealert -l ffa5fc5e-48af-419c-8a0b-c1eb5646c85e Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the dnf-utils file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. For complete SELinux messages run: sealert -l 4b7ba385-24e9-4ced-a524-692ba75994d2 Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the traceroute file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. For complete SELinux messages run: sealert -l dffcd2e1-ad86-4d6f-9885-da6c013c8153 Mar 09 20:19:09 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the consolehelper file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:10 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-upgrade. For complete SELinux messages run: sealert -l 68c8103d-9421-493f-bd9b-1d2694f735e7 Mar 09 20:19:10 np0005642945.novalocal systemd-rc-local-generator[94443]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:10 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-upgrade. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadb-upgrade file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:10 np0005642945.novalocal systemd-sysv-generator[94446]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:10 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/redis-server. For complete SELinux messages run: sealert -l 4cc19148-8cf3-4d4d-b6df-1549345a335b Mar 09 20:19:10 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/redis-server. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the redis-server file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:10 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. For complete SELinux messages run: sealert -l e74e7561-c81f-4104-890f-eeeabe3b3674 Mar 09 20:19:10 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadbd-safe file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:10 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:10 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. For complete SELinux messages run: sealert -l e3a2f937-13d1-4f4e-a499-ad479938f0cf Mar 09 20:19:10 np0005642945.novalocal setroubleshoot[94212]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the keepalived file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:19:10 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:10 np0005642945.novalocal trove-conductor[94374]: /usr/lib/python3.9/site-packages/oslo_db/sqlalchemy/enginefacade.py:373: NotSupportedWarning: Configuration option(s) ['idle_timeout'] not supported Mar 09 20:19:10 np0005642945.novalocal trove-conductor[94374]: warnings.warn( Mar 09 20:19:10 np0005642945.novalocal systemd-sysv-generator[94497]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:10 np0005642945.novalocal systemd-rc-local-generator[94493]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:10 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:10 np0005642945.novalocal systemd[1]: Started OpenStack Trove taskmanager service. Mar 09 20:19:11 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:11 np0005642945.novalocal systemd-sysv-generator[94540]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:11 np0005642945.novalocal systemd-rc-local-generator[94536]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:11 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:11 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:11 np0005642945.novalocal systemd-rc-local-generator[94576]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:11 np0005642945.novalocal systemd-sysv-generator[94581]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:11 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:11 np0005642945.novalocal runuser[94595]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:12 np0005642945.novalocal trove-taskmanager[94513]: /usr/lib/python3.9/site-packages/oslo_db/sqlalchemy/enginefacade.py:373: NotSupportedWarning: Configuration option(s) ['idle_timeout'] not supported Mar 09 20:19:12 np0005642945.novalocal trove-taskmanager[94513]: warnings.warn( Mar 09 20:19:12 np0005642945.novalocal runuser[94595]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:12 np0005642945.novalocal runuser[94649]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:13 np0005642945.novalocal runuser[94649]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:13 np0005642945.novalocal runuser[94702]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:13 np0005642945.novalocal systemd[1]: NetworkManager-dispatcher.service: Deactivated successfully. Mar 09 20:19:13 np0005642945.novalocal runuser[94702]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:13 np0005642945.novalocal runuser[94755]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:14 np0005642945.novalocal runuser[94755]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:15 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:15 np0005642945.novalocal systemd-rc-local-generator[94834]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:15 np0005642945.novalocal systemd-sysv-generator[94837]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:15 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:15 np0005642945.novalocal systemd[1]: Started Openstack Heat Engine Service. Mar 09 20:19:15 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:15 np0005642945.novalocal systemd-rc-local-generator[94876]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:15 np0005642945.novalocal systemd-sysv-generator[94880]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:15 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:16 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:16 np0005642945.novalocal systemd-rc-local-generator[94917]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:16 np0005642945.novalocal systemd-sysv-generator[94920]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:16 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:16 np0005642945.novalocal runuser[94939]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:17 np0005642945.novalocal runuser[94939]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:17 np0005642945.novalocal runuser[94991]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:17 np0005642945.novalocal runuser[94991]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:18 np0005642945.novalocal runuser[95048]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:18 np0005642945.novalocal runuser[95048]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:18 np0005642945.novalocal runuser[95108]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:19 np0005642945.novalocal runuser[95108]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:19 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:19 np0005642945.novalocal systemd-rc-local-generator[95188]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:19 np0005642945.novalocal systemd-sysv-generator[95193]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:19 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:20 np0005642945.novalocal systemd[1]: Started OpenStack Designate Mini DNS service. Mar 09 20:19:20 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@2.service: Deactivated successfully. Mar 09 20:19:20 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@2.service: Consumed 1.257s CPU time. Mar 09 20:19:20 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:20 np0005642945.novalocal systemd-rc-local-generator[95228]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:20 np0005642945.novalocal systemd-sysv-generator[95232]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:20 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:20 np0005642945.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Mar 09 20:19:20 np0005642945.novalocal systemd[1]: setroubleshootd.service: Consumed 1.517s CPU time. Mar 09 20:19:20 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:20 np0005642945.novalocal systemd-sysv-generator[95275]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:20 np0005642945.novalocal systemd-rc-local-generator[95271]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:20 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:21 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:21 np0005642945.novalocal systemd-rc-local-generator[95311]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:21 np0005642945.novalocal systemd-sysv-generator[95314]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:21 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:21 np0005642945.novalocal systemd[1]: Started OpenStack Designate Central service. Mar 09 20:19:21 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:21 np0005642945.novalocal systemd-sysv-generator[95365]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:21 np0005642945.novalocal systemd-rc-local-generator[95362]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:21 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:21 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:22 np0005642945.novalocal systemd-rc-local-generator[95397]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:22 np0005642945.novalocal systemd-sysv-generator[95402]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:22 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:22 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The designate API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The blacklist API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The blacklist API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The blacklist API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The blacklist API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The blacklist API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The blacklist API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The designate API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The designate API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The designate API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The designate API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The designate API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The pool API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The pool API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The pool API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The pool API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The pool API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The pool API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The pool API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The quota API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The quota API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The quota API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The records API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The records API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The record set API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The record set API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The record set API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The record set API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The record set API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The record set API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The record set API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The record set API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The service status API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The service status API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The service status API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The shared zones API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The shared zones API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The shared zones API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The shared zones API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The tenant API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The tenant API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The tenant API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone export API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone export API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone export API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone export API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone export API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone export API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone import API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone import API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone import API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone import API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone import API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:22 np0005642945.novalocal designate-central[95335]: warnings.warn(deprecated_msg) Mar 09 20:19:22 np0005642945.novalocal systemd-rc-local-generator[95444]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:22 np0005642945.novalocal systemd-sysv-generator[95450]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:22 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:22 np0005642945.novalocal systemd[1]: Started OpenStack Designate Producer service. Mar 09 20:19:23 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:23 np0005642945.novalocal systemd-rc-local-generator[95486]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:23 np0005642945.novalocal systemd-sysv-generator[95489]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:23 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:23 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:23 np0005642945.novalocal systemd-rc-local-generator[95526]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:23 np0005642945.novalocal systemd-sysv-generator[95529]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:23 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95544]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-central[95419]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95545]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95546]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The blacklist API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The designate API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The pool API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The quota API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The records API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The record set API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The service status API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The shared zones API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The tenant API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone export API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone import API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:23 np0005642945.novalocal designate-producer[95547]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The quota API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The quota API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The quota API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The records API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The records API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The service status API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The service status API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The service status API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The tenant API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The tenant API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The tenant API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95422]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The quota API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The quota API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The quota API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The records API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The records API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The blacklist API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The designate API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The service status API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The service status API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The service status API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The pool API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The quota API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The quota API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The quota API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The records API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The tenant API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The records API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The tenant API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The tenant API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The record set API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The service status API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The service status API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The service status API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The shared zones API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The tenant API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The tenant API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The tenant API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The top-level domain API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The tsigkey API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone export API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95421]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone import API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: The zone transfer request API now supports system scope and default roles. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:19:24 np0005642945.novalocal designate-central[95420]: warnings.warn(deprecated_msg) Mar 09 20:19:24 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:24 np0005642945.novalocal systemd-rc-local-generator[95576]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:24 np0005642945.novalocal systemd-sysv-generator[95582]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:24 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:24 np0005642945.novalocal systemd[1]: Started OpenStack Designate Worker service. Mar 09 20:19:24 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:24 np0005642945.novalocal systemd-rc-local-generator[95639]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:24 np0005642945.novalocal systemd-sysv-generator[95643]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:24 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:24 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:25 np0005642945.novalocal systemd-sysv-generator[95680]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:25 np0005642945.novalocal systemd-rc-local-generator[95675]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:25 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:25 np0005642945.novalocal runuser[95693]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:25 np0005642945.novalocal runuser[95693]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:26 np0005642945.novalocal runuser[95749]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:26 np0005642945.novalocal runuser[95749]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:26 np0005642945.novalocal runuser[95802]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:27 np0005642945.novalocal runuser[95802]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:27 np0005642945.novalocal runuser[95854]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:27 np0005642945.novalocal runuser[95854]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:28 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:28 np0005642945.novalocal systemd-rc-local-generator[95932]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:28 np0005642945.novalocal systemd-sysv-generator[95938]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:28 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:28 np0005642945.novalocal systemd[1]: Started Mistral Engine Server. Mar 09 20:19:29 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:29 np0005642945.novalocal systemd-rc-local-generator[95975]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:29 np0005642945.novalocal systemd-sysv-generator[95978]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:29 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:29 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:29 np0005642945.novalocal systemd-rc-local-generator[96014]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:29 np0005642945.novalocal systemd-sysv-generator[96017]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:29 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:30 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:30 np0005642945.novalocal systemd-rc-local-generator[96061]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:30 np0005642945.novalocal systemd-sysv-generator[96066]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:30 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:30 np0005642945.novalocal systemd[1]: Started Mistral Executor Server. Mar 09 20:19:30 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:30 np0005642945.novalocal systemd-rc-local-generator[96104]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:30 np0005642945.novalocal systemd-sysv-generator[96108]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:30 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:31 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:31 np0005642945.novalocal systemd-rc-local-generator[96141]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:31 np0005642945.novalocal systemd-sysv-generator[96146]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:31 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:31 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:31 np0005642945.novalocal systemd-rc-local-generator[96182]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:31 np0005642945.novalocal systemd-sysv-generator[96186]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:31 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:32 np0005642945.novalocal systemd[1]: Started Mistral Event Engine Server. Mar 09 20:19:32 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:32 np0005642945.novalocal systemd-rc-local-generator[96223]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:32 np0005642945.novalocal systemd-sysv-generator[96226]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:32 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:32 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:32 np0005642945.novalocal systemd-rc-local-generator[96263]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:32 np0005642945.novalocal systemd-sysv-generator[96266]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:32 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:32 np0005642945.novalocal runuser[96282]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:33 np0005642945.novalocal runuser[96282]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:33 np0005642945.novalocal runuser[96335]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:34 np0005642945.novalocal runuser[96335]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:34 np0005642945.novalocal runuser[96390]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:35 np0005642945.novalocal runuser[96390]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:35 np0005642945.novalocal runuser[96478]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:35 np0005642945.novalocal runuser[96478]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:36 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:36 np0005642945.novalocal systemd-rc-local-generator[96556]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:36 np0005642945.novalocal systemd-sysv-generator[96561]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:36 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:36 np0005642945.novalocal systemd[1]: Started Openstack Barbican worker daemon. Mar 09 20:19:36 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:36 np0005642945.novalocal systemd-sysv-generator[96599]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:36 np0005642945.novalocal systemd-rc-local-generator[96596]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:36 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:37 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:37 np0005642945.novalocal systemd-sysv-generator[96641]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:37 np0005642945.novalocal systemd-rc-local-generator[96636]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:37 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:37 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/openstack-barbican-api.service:15: Standard output type syslog is obsolete, automatically updating to journal. Please update your unit file, and consider removing the setting altogether. Mar 09 20:19:37 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/openstack-barbican-api.service:15: Standard output type syslog is obsolete, automatically updating to journal. Please update your unit file, and consider removing the setting altogether. Mar 09 20:19:37 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:38 np0005642945.novalocal systemd-rc-local-generator[96684]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:38 np0005642945.novalocal systemd-sysv-generator[96688]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:38 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:38 np0005642945.novalocal systemd[1]: Started Openstack Barbican worker daemon. Mar 09 20:19:38 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:38 np0005642945.novalocal systemd-rc-local-generator[96723]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:38 np0005642945.novalocal systemd-sysv-generator[96727]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:38 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:38 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:39 np0005642945.novalocal systemd-sysv-generator[96769]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:39 np0005642945.novalocal systemd-rc-local-generator[96764]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:39 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:39 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:39 np0005642945.novalocal systemd-rc-local-generator[96807]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:39 np0005642945.novalocal systemd-sysv-generator[96814]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:39 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:40 np0005642945.novalocal systemd[1]: Started Openstack Barbican Retry daemon. Mar 09 20:19:40 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:40 np0005642945.novalocal sshd-session[96825]: Connection closed by authenticating user root 167.71.115.113 port 47692 [preauth] Mar 09 20:19:40 np0005642945.novalocal systemd-sysv-generator[96856]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:40 np0005642945.novalocal systemd-rc-local-generator[96853]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:40 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:40 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:40 np0005642945.novalocal systemd-sysv-generator[96893]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:40 np0005642945.novalocal systemd-rc-local-generator[96889]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:40 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:41 np0005642945.novalocal runuser[96909]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:41 np0005642945.novalocal runuser[96909]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:41 np0005642945.novalocal runuser[96962]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:42 np0005642945.novalocal runuser[96962]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:42 np0005642945.novalocal runuser[97015]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:43 np0005642945.novalocal runuser[97015]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:43 np0005642945.novalocal runuser[97067]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:19:43 np0005642945.novalocal runuser[97067]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:19:44 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:44 np0005642945.novalocal systemd-rc-local-generator[97143]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:44 np0005642945.novalocal systemd-sysv-generator[97148]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:44 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:44 np0005642945.novalocal systemd[1]: Started OpenStack Magnum API Service. Mar 09 20:19:44 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:44 np0005642945.novalocal systemd-sysv-generator[97190]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:44 np0005642945.novalocal systemd-rc-local-generator[97187]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:44 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:45 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:45 np0005642945.novalocal systemd-sysv-generator[97232]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:45 np0005642945.novalocal systemd-rc-local-generator[97227]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:45 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:45 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:45 np0005642945.novalocal magnum-api[97164]: Using RPC transport for notifications. Please use get_notification_transport to obtain a notification transport instance. Mar 09 20:19:45 np0005642945.novalocal systemd-rc-local-generator[97269]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:45 np0005642945.novalocal systemd-sysv-generator[97274]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:45 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:46 np0005642945.novalocal systemd[1]: Started Openstack Magnum Conductor Service. Mar 09 20:19:46 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:46 np0005642945.novalocal systemd-rc-local-generator[97310]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:46 np0005642945.novalocal systemd-sysv-generator[97313]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:46 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:46 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:46 np0005642945.novalocal systemd-rc-local-generator[97351]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:46 np0005642945.novalocal systemd-sysv-generator[97354]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:46 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:47 np0005642945.novalocal magnum-conductor[97288]: Using RPC transport for notifications. Please use get_notification_transport to obtain a notification transport instance. Mar 09 20:19:48 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:19:48 np0005642945.novalocal systemd-rc-local-generator[97400]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:19:48 np0005642945.novalocal systemd-sysv-generator[97404]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:19:48 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:19:48 np0005642945.novalocal systemd[1]: Starting One-time temporary TLS key generation for httpd.service... Mar 09 20:19:48 np0005642945.novalocal systemd[1]: httpd-init.service: Deactivated successfully. Mar 09 20:19:48 np0005642945.novalocal systemd[1]: Finished One-time temporary TLS key generation for httpd.service. Mar 09 20:19:48 np0005642945.novalocal systemd[1]: Starting The Apache HTTP Server... Mar 09 20:20:00 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:20:00 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:20:00 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:20:05 np0005642945.novalocal httpd[97438]: Server configured, listening on: ::1 port 9311, ... Mar 09 20:20:05 np0005642945.novalocal systemd[1]: Started The Apache HTTP Server. Mar 09 20:20:05 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:20:05 np0005642945.novalocal systemd-rc-local-generator[97567]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:20:05 np0005642945.novalocal systemd-sysv-generator[97573]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:20:05 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:20:05 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:20:05 np0005642945.novalocal systemd-rc-local-generator[97620]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:20:05 np0005642945.novalocal systemd-sysv-generator[97624]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:20:05 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:20:06 np0005642945.novalocal crontab[97639]: (root) REPLACE (keystone) Mar 09 20:20:09 np0005642945.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Mar 09 20:20:09 np0005642945.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Mar 09 20:20:10 np0005642945.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@3.service. Mar 09 20:20:11 np0005642945.novalocal setroubleshoot[97643]: SELinux is preventing /usr/sbin/httpd from write access on the directory /var/lib/keystone/(null). For complete SELinux messages run: sealert -l 6ef2931d-f1dc-41a7-a982-bed8113bc318 Mar 09 20:20:11 np0005642945.novalocal setroubleshoot[97643]: SELinux is preventing /usr/sbin/httpd from write access on the directory /var/lib/keystone/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed write access on the (null) directory by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:20:11 np0005642945.novalocal setroubleshoot[97643]: SELinux is preventing /usr/sbin/httpd from add_name access on the directory /var/lib/keystone/(null). For complete SELinux messages run: sealert -l 70ef88a3-2539-4d0a-8c97-5765456a0288 Mar 09 20:20:11 np0005642945.novalocal setroubleshoot[97643]: SELinux is preventing /usr/sbin/httpd from add_name access on the directory /var/lib/keystone/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed add_name access on the (null) directory by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:20:11 np0005642945.novalocal setroubleshoot[97643]: SELinux is preventing /usr/sbin/httpd from create access on the file /var/lib/keystone/(null). For complete SELinux messages run: sealert -l 90bd0992-9cdd-4f05-b461-c1e861c92ba1 Mar 09 20:20:11 np0005642945.novalocal setroubleshoot[97643]: SELinux is preventing /usr/sbin/httpd from create access on the file /var/lib/keystone/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed create access on the (null) file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:20:11 np0005642945.novalocal setroubleshoot[97643]: failed to retrieve rpm info for path '/var/lib/keystone/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878': Mar 09 20:20:11 np0005642945.novalocal setroubleshoot[97643]: SELinux is preventing /usr/sbin/httpd from write access on the file /var/lib/keystone/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. For complete SELinux messages run: sealert -l 75a07b2c-b193-4c3a-82c0-587ad5ecdee3 Mar 09 20:20:11 np0005642945.novalocal setroubleshoot[97643]: SELinux is preventing /usr/sbin/httpd from write access on the file /var/lib/keystone/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed write access on the 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:20:21 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@3.service: Deactivated successfully. Mar 09 20:20:21 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@3.service: Consumed 1.182s CPU time. Mar 09 20:20:21 np0005642945.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Mar 09 20:20:21 np0005642945.novalocal systemd[1]: setroubleshootd.service: Consumed 1.281s CPU time. Mar 09 20:21:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:21:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:21:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:21:03 np0005642945.novalocal systemd[1]: libvirtd.service: Deactivated successfully. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The records API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The records API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95701]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The records API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The records API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95702]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The records API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The records API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95705]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "default":"rule:admin_or_owner" was deprecated in W in favor of "default":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_blacklist":"rule:admin" was deprecated in W in favor of "create_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_blacklists":"rule:admin" was deprecated in W in favor of "find_blacklists":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_blacklist":"rule:admin" was deprecated in W in favor of "get_blacklist":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_blacklist":"rule:admin" was deprecated in W in favor of "update_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_blacklist":"rule:admin" was deprecated in W in favor of "delete_blacklist":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_blacklisted_zone":"rule:admin" was deprecated in W in favor of "use_blacklisted_zone":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The blacklist API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "all_tenants":"rule:admin" was deprecated in W in favor of "all_tenants":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "edit_managed_records":"rule:admin" was deprecated in W in favor of "edit_managed_records":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_low_ttl":"rule:admin" was deprecated in W in favor of "use_low_ttl":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "use_sudo":"rule:admin" was deprecated in W in favor of "use_sudo":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "hard_delete":"rule:admin" was deprecated in W in favor of "hard_delete":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The designate API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_pool":"rule:admin" was deprecated in W in favor of "create_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pools":"rule:admin" was deprecated in W in favor of "find_pools":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_pool":"rule:admin" was deprecated in W in favor of "find_pool":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_pool":"rule:admin" was deprecated in W in favor of "get_pool":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_pool":"rule:admin" was deprecated in W in favor of "update_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_pool":"rule:admin" was deprecated in W in favor of "delete_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_create_forced_pool":"rule:admin" was deprecated in W in favor of "zone_create_forced_pool":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The pool API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_quotas":"rule:admin_or_owner" was deprecated in W in favor of "get_quotas":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or (True:%(all_tenants)s and role:reader)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "set_quota":"rule:admin" was deprecated in W in favor of "set_quota":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "reset_quotas":"rule:admin" was deprecated in W in favor of "reset_quotas":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The quota API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_records":"rule:admin_or_owner" was deprecated in W in favor of "find_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The records API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_records":"rule:admin_or_owner" was deprecated in W in favor of "count_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The records API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_recordset":"('PRIMARY':%(zone_type)s AND (rule:admin_or_owner OR 'True':%(zone_shared)s)) OR ('SECONDARY':%(zone_type)s AND is_admin:True)" was deprecated in W in favor of "create_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or ("True":%(zone_shared)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "get_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_recordset":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordset":"rule:admin_or_owner" was deprecated in W in favor of "find_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_recordsets":"rule:admin_or_owner" was deprecated in W in favor of "find_recordsets":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "update_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_recordset":"rule:admin or ('PRIMARY':%(zone_type)s and (rule:owner or project_id:%(recordset_project_id)s))" was deprecated in W in favor of "delete_recordset":"(role:member and project_id:%(project_id)s) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('PRIMARY':%(zone_type)s) or (role:admin and system_scope:all) and ('SECONDARY':%(zone_type)s) or role:member and (project_id:%(recordset_project_id)s) and ('PRIMARY':%(zone_type)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_recordset":"rule:admin_or_owner" was deprecated in W in favor of "count_recordset":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The record set API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_status":"rule:admin" was deprecated in W in favor of "find_service_status":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_service_statuses":"rule:admin" was deprecated in W in favor of "find_service_statuses":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_service_status":"rule:admin" was deprecated in W in favor of "update_service_status":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The service status API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "share_zone":"rule:admin_or_owner" was deprecated in W in favor of "share_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_project_zone_share":"rule:admin_or_owner" was deprecated in W in favor of "find_project_zone_share":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "unshare_zone":"rule:admin_or_owner" was deprecated in W in favor of "unshare_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The shared zones API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tenants":"rule:admin" was deprecated in W in favor of "find_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tenant":"rule:admin" was deprecated in W in favor of "get_tenant":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_tenants":"rule:admin" was deprecated in W in favor of "count_tenants":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The tenant API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tld":"rule:admin" was deprecated in W in favor of "create_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tlds":"rule:admin" was deprecated in W in favor of "find_tlds":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tld":"rule:admin" was deprecated in W in favor of "get_tld":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tld":"rule:admin" was deprecated in W in favor of "update_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tld":"rule:admin" was deprecated in W in favor of "delete_tld":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The top-level domain API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_tsigkey":"rule:admin" was deprecated in W in favor of "create_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_tsigkeys":"rule:admin" was deprecated in W in favor of "find_tsigkeys":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_tsigkey":"rule:admin" was deprecated in W in favor of "get_tsigkey":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_tsigkey":"rule:admin" was deprecated in W in favor of "update_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_tsigkey":"rule:admin" was deprecated in W in favor of "delete_tsigkey":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The tsigkey API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone":"rule:admin_or_owner" was deprecated in W in favor of "create_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zones":"rule:admin_or_owner" was deprecated in W in favor of "get_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone":"rule:admin_or_owner or ("True":%(zone_shared)s)" was deprecated in W in favor of "get_zone":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s) or ("True":%(zone_shared)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_servers":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_servers":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_ns_records":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_ns_records":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zones":"rule:admin_or_owner" was deprecated in W in favor of "find_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone":"rule:admin_or_owner" was deprecated in W in favor of "update_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "xfr_zone":"rule:admin_or_owner" was deprecated in W in favor of "xfr_zone":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "abandon_zone":"rule:admin" was deprecated in W in favor of "abandon_zone":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones":"rule:admin_or_owner" was deprecated in W in favor of "count_zones":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "count_zones_pending_notify":"rule:admin_or_owner" was deprecated in W in favor of "count_zones_pending_notify":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "purge_zones":"rule:admin" was deprecated in W in favor of "purge_zones":"role:admin and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "zone_export":"rule:admin_or_owner" was deprecated in W in favor of "zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_exports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_exports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_export":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_export":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_export":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone export API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_imports":"rule:admin_or_owner" was deprecated in W in favor of "find_zone_imports":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_import":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_import":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_import":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone import API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_accept":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "create_zone_transfer_accept":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_accept":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_accept":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "find_zone_transfer_accepts":"rule:admin" was deprecated in W in favor of "find_zone_transfer_accepts":"role:reader and system_scope:all". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone transfer accept API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "create_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "get_zone_transfer_request":"rule:admin_or_owner OR project_id:%(target_tenant_id)s OR None:%(target_tenant_id)s" was deprecated in W in favor of "get_zone_transfer_request":"((role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)) or project_id:%(target_project_id)s or None:%(target_project_id)s". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "create_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "get_zone_transfer_request_detailed":"(role:reader and system_scope:all) or (role:reader and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "update_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "update_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:809: UserWarning: Policy "delete_zone_transfer_request":"rule:admin_or_owner" was deprecated in W in favor of "delete_zone_transfer_request":"(role:admin and system_scope:all) or (role:member and project_id:%(project_id)s)". Reason: Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: The zone transfer request API now supports system scope and default roles. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: . Either ensure your deployment is ready for the new default or copy/paste the deprecated policy into your policy file and maintain it manually. Mar 09 20:21:23 np0005642945.novalocal designate-worker[95704]: warnings.warn(deprecated_msg) Mar 09 20:22:01 np0005642945.novalocal anacron[2824]: Job `cron.daily' started Mar 09 20:22:01 np0005642945.novalocal anacron[2824]: Job `cron.daily' terminated Mar 09 20:22:01 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:22:01 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:22:01 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:23:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:23:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:23:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:24:02 np0005642945.novalocal systemd[93370]: Created slice User Background Tasks Slice. Mar 09 20:24:02 np0005642945.novalocal systemd[93370]: Starting Cleanup of User's Temporary Files and Directories... Mar 09 20:24:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:24:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:24:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:24:02 np0005642945.novalocal systemd[93370]: Finished Cleanup of User's Temporary Files and Directories. Mar 09 20:25:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:25:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:25:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:26:04 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:26:04 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:26:04 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:27:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:27:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:27:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:27:57 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:27:57 np0005642945.novalocal systemd-sysv-generator[98274]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:27:57 np0005642945.novalocal systemd-rc-local-generator[98269]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:27:57 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:27:57 np0005642945.novalocal systemd[1]: Starting OpenStack Nova Conductor Server... Mar 09 20:27:59 np0005642945.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Mar 09 20:27:59 np0005642945.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Mar 09 20:28:00 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:28:00 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:28:00 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:28:00 np0005642945.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@4.service. Mar 09 20:28:01 np0005642945.novalocal systemd[1]: Started OpenStack Nova Conductor Server. Mar 09 20:28:01 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:28:01 np0005642945.novalocal systemd-rc-local-generator[98338]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:28:01 np0005642945.novalocal systemd-sysv-generator[98341]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:28:01 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:28:01 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:28:01 np0005642945.novalocal systemd-rc-local-generator[98376]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:28:01 np0005642945.novalocal systemd-sysv-generator[98379]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:28:01 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:28:01 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. For complete SELinux messages run: sealert -l 69867177-a959-4242-aeac-944fdd481302 Mar 09 20:28:01 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the hostname file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:01 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. For complete SELinux messages run: sealert -l da7baf01-d2b7-4f2c-9790-25af599c9011 Mar 09 20:28:01 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the rpm file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. For complete SELinux messages run: sealert -l 4bb12bf8-8af6-4967-98d0-e8f710ad410d Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the gpg file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b20a522-0da0-4b6a-a041-b36356dfd5ce Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. For complete SELinux messages run: sealert -l ffa5fc5e-48af-419c-8a0b-c1eb5646c85e Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the dnf-utils file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. For complete SELinux messages run: sealert -l 4b7ba385-24e9-4ced-a524-692ba75994d2 Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the traceroute file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. For complete SELinux messages run: sealert -l dffcd2e1-ad86-4d6f-9885-da6c013c8153 Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the consolehelper file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-upgrade. For complete SELinux messages run: sealert -l 68c8103d-9421-493f-bd9b-1d2694f735e7 Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-upgrade. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadb-upgrade file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/redis-server. For complete SELinux messages run: sealert -l 4cc19148-8cf3-4d4d-b6df-1549345a335b Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/redis-server. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the redis-server file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. For complete SELinux messages run: sealert -l e74e7561-c81f-4104-890f-eeeabe3b3674 Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadbd-safe file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. For complete SELinux messages run: sealert -l e3a2f937-13d1-4f4e-a499-ad479938f0cf Mar 09 20:28:02 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the keepalived file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:02 np0005642945.novalocal systemd-sysv-generator[98436]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:28:02 np0005642945.novalocal systemd-rc-local-generator[98432]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:28:02 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:28:02 np0005642945.novalocal systemd[1]: Starting OpenStack Nova Compute Server... Mar 09 20:28:07 np0005642945.novalocal systemd[1]: Started OpenStack Nova Compute Server. Mar 09 20:28:07 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:28:07 np0005642945.novalocal systemd-rc-local-generator[98505]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:28:07 np0005642945.novalocal systemd-sysv-generator[98509]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:28:07 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:28:08 np0005642945.novalocal systemd[1]: Starting libvirt legacy monolithic daemon... Mar 09 20:28:08 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:28:08 np0005642945.novalocal systemd-rc-local-generator[98569]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:28:08 np0005642945.novalocal systemd-sysv-generator[98574]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:28:08 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:28:08 np0005642945.novalocal systemd[1]: Started libvirt legacy monolithic daemon. Mar 09 20:28:08 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:28:09 np0005642945.novalocal systemd-rc-local-generator[98639]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:28:09 np0005642945.novalocal systemd-sysv-generator[98642]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:28:09 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:28:09 np0005642945.novalocal systemd[1]: Starting OpenStack Nova Scheduler Server... Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. For complete SELinux messages run: sealert -l 69867177-a959-4242-aeac-944fdd481302 Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the hostname file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. For complete SELinux messages run: sealert -l da7baf01-d2b7-4f2c-9790-25af599c9011 Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the rpm file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. For complete SELinux messages run: sealert -l 4bb12bf8-8af6-4967-98d0-e8f710ad410d Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the gpg file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b20a522-0da0-4b6a-a041-b36356dfd5ce Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. For complete SELinux messages run: sealert -l ffa5fc5e-48af-419c-8a0b-c1eb5646c85e Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the dnf-utils file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. For complete SELinux messages run: sealert -l 4b7ba385-24e9-4ced-a524-692ba75994d2 Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the traceroute file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. For complete SELinux messages run: sealert -l dffcd2e1-ad86-4d6f-9885-da6c013c8153 Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the consolehelper file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-upgrade. For complete SELinux messages run: sealert -l 68c8103d-9421-493f-bd9b-1d2694f735e7 Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-upgrade. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadb-upgrade file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/redis-server. For complete SELinux messages run: sealert -l 4cc19148-8cf3-4d4d-b6df-1549345a335b Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/redis-server. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the redis-server file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. For complete SELinux messages run: sealert -l e74e7561-c81f-4104-890f-eeeabe3b3674 Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadbd-safe file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. For complete SELinux messages run: sealert -l e3a2f937-13d1-4f4e-a499-ad479938f0cf Mar 09 20:28:11 np0005642945.novalocal setroubleshoot[98290]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the keepalived file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Mar 09 20:28:11 np0005642945.novalocal systemd[1]: Started OpenStack Nova Scheduler Server. Mar 09 20:28:12 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:28:12 np0005642945.novalocal systemd-rc-local-generator[98697]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:28:12 np0005642945.novalocal systemd-sysv-generator[98700]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:28:12 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:28:12 np0005642945.novalocal systemd[1]: Reloading. Mar 09 20:28:12 np0005642945.novalocal systemd-rc-local-generator[98737]: /etc/rc.d/rc.local is not marked executable, skipping. Mar 09 20:28:12 np0005642945.novalocal systemd-sysv-generator[98740]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Mar 09 20:28:12 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/ovn-controller.service:24: PIDFile= references a path below legacy directory /var/run/, updating /var/run/ovn/ovn-controller.pid → /run/ovn/ovn-controller.pid; please update the unit file accordingly. Mar 09 20:28:21 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@4.service: Deactivated successfully. Mar 09 20:28:21 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@4.service: Consumed 1.297s CPU time. Mar 09 20:28:21 np0005642945.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Mar 09 20:28:21 np0005642945.novalocal systemd[1]: setroubleshootd.service: Consumed 2.006s CPU time. Mar 09 20:28:48 np0005642945.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Mar 09 20:28:49 np0005642945.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Mar 09 20:28:49 np0005642945.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@5.service. Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from write access on the directory /var/lib/nova/(null). For complete SELinux messages run: sealert -l 936aa267-915e-40e4-98bc-35357be79d9c Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from write access on the directory /var/lib/nova/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed write access on the (null) directory by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from add_name access on the directory /var/lib/nova/(null). For complete SELinux messages run: sealert -l 726e0ef9-394e-4689-bb72-80f7e40ccee7 Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from add_name access on the directory /var/lib/nova/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed add_name access on the (null) directory by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from create access on the file /var/lib/nova/(null). For complete SELinux messages run: sealert -l 7d3615e8-974b-475a-ab6b-b4ea8928533c Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from create access on the file /var/lib/nova/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed create access on the (null) file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: failed to retrieve rpm info for path '/var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878': Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from 'write, open' accesses on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. For complete SELinux messages run: sealert -l c97bc824-671b-4b90-a633-07f53a892611 Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from 'write, open' accesses on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed write open access on the 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from getattr access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. For complete SELinux messages run: sealert -l 8f6b0073-155d-4ffc-9180-49ce46fb3ff2 Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from getattr access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed getattr access on the 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from ioctl access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. For complete SELinux messages run: sealert -l df3ae8d0-740c-43b0-8c77-8c2b346c6689 Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from ioctl access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed ioctl access on the 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from read access on the file 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. For complete SELinux messages run: sealert -l bb9e20e7-ab89-479d-827c-e75663a392ed Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from read access on the file 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed read access on the 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from open access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. For complete SELinux messages run: sealert -l 8cf73d48-da64-447a-acfe-9d6817bebfdd Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from open access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed open access on the 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from getattr access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. For complete SELinux messages run: sealert -l 8f6b0073-155d-4ffc-9180-49ce46fb3ff2 Mar 09 20:28:51 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from getattr access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed getattr access on the 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:28:52 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from ioctl access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. For complete SELinux messages run: sealert -l df3ae8d0-740c-43b0-8c77-8c2b346c6689 Mar 09 20:28:52 np0005642945.novalocal setroubleshoot[98809]: SELinux is preventing /usr/sbin/httpd from ioctl access on the file /var/lib/nova/.cache/python-entrypoints/0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed ioctl access on the 0233c4e6790c702667c8be81e26612de1178ec45a7455f8f185f1ca048404878 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Mar 09 20:29:02 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@5.service: Deactivated successfully. Mar 09 20:29:02 np0005642945.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@5.service: Consumed 1.408s CPU time. Mar 09 20:29:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:29:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:29:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:29:02 np0005642945.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Mar 09 20:29:02 np0005642945.novalocal systemd[1]: setroubleshootd.service: Consumed 1.326s CPU time. Mar 09 20:29:18 np0005642945.novalocal runuser[98992]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:29:18 np0005642945.novalocal runuser[98992]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:29:18 np0005642945.novalocal runuser[99045]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:29:19 np0005642945.novalocal runuser[99045]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:29:19 np0005642945.novalocal runuser[99099]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:29:20 np0005642945.novalocal runuser[99099]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:29:49 np0005642945.novalocal systemd[1]: Stopping Redis persistent key-value database... Mar 09 20:29:49 np0005642945.novalocal redis-shutdown[99525]: Warning: Using a password with '-a' or '-u' option on the command line interface may not be safe. Mar 09 20:29:49 np0005642945.novalocal systemd[1]: redis.service: Deactivated successfully. Mar 09 20:29:49 np0005642945.novalocal systemd[1]: Stopped Redis persistent key-value database. Mar 09 20:29:49 np0005642945.novalocal systemd[1]: redis.service: Consumed 1.597s CPU time, 10.3M memory peak. Mar 09 20:29:49 np0005642945.novalocal systemd[1]: Starting Redis persistent key-value database... Mar 09 20:29:49 np0005642945.novalocal systemd[1]: Started Redis persistent key-value database. Mar 09 20:30:01 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:30:01 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:30:01 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:30:01 np0005642945.novalocal systemd[1]: Created slice User Slice of UID 163. Mar 09 20:30:01 np0005642945.novalocal systemd[1]: Starting User Runtime Directory /run/user/163... Mar 09 20:30:01 np0005642945.novalocal systemd[1]: Finished User Runtime Directory /run/user/163. Mar 09 20:30:01 np0005642945.novalocal systemd[1]: Starting User Manager for UID 163... Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: pam_unix(systemd-user:session): session opened for user keystone(uid=163) by keystone(uid=0) Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Failed to resolve symlink /root/.local/share/flatpak/exports/share/systemd/user, ignoring: Permission denied Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Failed to open "/root/.local/share/flatpak/exports/share/systemd/user", ignoring: Permission denied Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Queued start job for default target Main User Target. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Created slice User Application Slice. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Mark boot as successful after the user session has run 2 minutes was skipped because of an unmet condition check (ConditionUser=!@system). Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Started Daily Cleanup of User's Temporary Directories. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Reached target Paths. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Reached target Timers. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Starting D-Bus User Message Bus Socket... Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Listening on PipeWire PulseAudio. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Listening on PipeWire Multimedia System Sockets. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Starting Create User's Volatile Files and Directories... Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Listening on D-Bus User Message Bus Socket. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Reached target Sockets. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Finished Create User's Volatile Files and Directories. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Reached target Basic System. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Reached target Main User Target. Mar 09 20:30:01 np0005642945.novalocal systemd[99547]: Startup finished in 162ms. Mar 09 20:30:01 np0005642945.novalocal systemd[1]: Started User Manager for UID 163. Mar 09 20:30:01 np0005642945.novalocal systemd[1]: Started Session 5 of User keystone. Mar 09 20:30:01 np0005642945.novalocal CROND[99555]: (keystone) CMD (keystone-manage fernet_rotate) Mar 09 20:30:02 np0005642945.novalocal systemd[1]: Stopping Berkeley Internet Name Domain (DNS)... Mar 09 20:30:02 np0005642945.novalocal named[90783]: received control channel command 'stop' Mar 09 20:30:02 np0005642945.novalocal named[90783]: no longer listening on ::1#5322 Mar 09 20:30:02 np0005642945.novalocal named[90783]: shutting down: flushing changes Mar 09 20:30:02 np0005642945.novalocal named[90783]: stopping command channel on ::1#953 Mar 09 20:30:02 np0005642945.novalocal named[90783]: exiting Mar 09 20:30:02 np0005642945.novalocal systemd[1]: named.service: Deactivated successfully. Mar 09 20:30:02 np0005642945.novalocal systemd[1]: Stopped Berkeley Internet Name Domain (DNS). Mar 09 20:30:02 np0005642945.novalocal systemd[1]: Starting Generate rndc key for BIND (DNS)... Mar 09 20:30:02 np0005642945.novalocal systemd[1]: named-setup-rndc.service: Deactivated successfully. Mar 09 20:30:02 np0005642945.novalocal systemd[1]: Finished Generate rndc key for BIND (DNS). Mar 09 20:30:02 np0005642945.novalocal systemd[1]: Starting Berkeley Internet Name Domain (DNS)... Mar 09 20:30:02 np0005642945.novalocal bash[99575]: zone localhost.localdomain/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal bash[99575]: zone localhost/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal bash[99575]: zone 1.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.ip6.arpa/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal bash[99575]: zone 1.0.0.127.in-addr.arpa/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal bash[99575]: zone 0.in-addr.arpa/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal named[99577]: starting BIND 9.16.23-RH (Extended Support Version) Mar 09 20:30:02 np0005642945.novalocal named[99577]: running on Linux x86_64 5.14.0-687.el9.x86_64 #1 SMP PREEMPT_DYNAMIC Mon Feb 23 11:11:46 UTC 2026 Mar 09 20:30:02 np0005642945.novalocal named[99577]: built with '--build=x86_64-redhat-linux-gnu' '--host=x86_64-redhat-linux-gnu' '--program-prefix=' '--disable-dependency-tracking' '--prefix=/usr' '--exec-prefix=/usr' '--bindir=/usr/bin' '--sbindir=/usr/sbin' '--sysconfdir=/etc' '--datadir=/usr/share' '--includedir=/usr/include' '--libdir=/usr/lib64' '--libexecdir=/usr/libexec' '--sharedstatedir=/var/lib' '--mandir=/usr/share/man' '--infodir=/usr/share/info' '--with-python=/usr/bin/python3' '--with-libtool' '--localstatedir=/var' '--with-pic' '--disable-static' '--includedir=/usr/include/bind9' '--with-tuning=large' '--with-libidn2' '--with-maxminddb' '--with-dlopen=yes' '--with-gssapi=yes' '--with-lmdb=yes' '--without-libjson' '--with-json-c' '--enable-dnstap' '--enable-fixed-rrset' '--enable-full-report' 'build_alias=x86_64-redhat-linux-gnu' 'host_alias=x86_64-redhat-linux-gnu' 'CC=gcc' 'CFLAGS= -O2 -flto=auto -ffat-lto-objects -fexceptions -g -grecord-gcc-switches -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -fstack-protector-strong -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=x86-64-v2 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protection' 'LDFLAGS=-Wl,-z,relro -Wl,--as-needed -Wl,-z,now -specs=/usr/lib/rpm/redhat/redhat-hardened-ld -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 ' 'LT_SYS_LIBRARY_PATH=/usr/lib64:' 'PKG_CONFIG_PATH=:/usr/lib64/pkgconfig:/usr/share/pkgconfig' Mar 09 20:30:02 np0005642945.novalocal named[99577]: running as: named -u named -c /etc/named.conf Mar 09 20:30:02 np0005642945.novalocal named[99577]: compiled by GCC 11.5.0 20240719 (Red Hat 11.5.0-14) Mar 09 20:30:02 np0005642945.novalocal named[99577]: compiled with OpenSSL version: OpenSSL 3.5.1 1 Jul 2025 Mar 09 20:30:02 np0005642945.novalocal named[99577]: linked to OpenSSL version: OpenSSL 3.5.5 27 Jan 2026 Mar 09 20:30:02 np0005642945.novalocal named[99577]: compiled with libxml2 version: 2.9.13 Mar 09 20:30:02 np0005642945.novalocal named[99577]: linked to libxml2 version: 20913 Mar 09 20:30:02 np0005642945.novalocal named[99577]: compiled with json-c version: 0.14 Mar 09 20:30:02 np0005642945.novalocal named[99577]: linked to json-c version: 0.14 Mar 09 20:30:02 np0005642945.novalocal named[99577]: compiled with zlib version: 1.2.11 Mar 09 20:30:02 np0005642945.novalocal named[99577]: linked to zlib version: 1.2.11 Mar 09 20:30:02 np0005642945.novalocal named[99577]: ---------------------------------------------------- Mar 09 20:30:02 np0005642945.novalocal named[99577]: BIND 9 is maintained by Internet Systems Consortium, Mar 09 20:30:02 np0005642945.novalocal named[99577]: Inc. (ISC), a non-profit 501(c)(3) public-benefit Mar 09 20:30:02 np0005642945.novalocal named[99577]: corporation. Support and training for BIND 9 are Mar 09 20:30:02 np0005642945.novalocal named[99577]: available at https://www.isc.org/support Mar 09 20:30:02 np0005642945.novalocal named[99577]: ---------------------------------------------------- Mar 09 20:30:02 np0005642945.novalocal named[99577]: adjusted limit on open files from 524288 to 1048576 Mar 09 20:30:02 np0005642945.novalocal named[99577]: found 8 CPUs, using 8 worker threads Mar 09 20:30:02 np0005642945.novalocal named[99577]: using 8 UDP listeners per interface Mar 09 20:30:02 np0005642945.novalocal named[99577]: using up to 21000 sockets Mar 09 20:30:02 np0005642945.novalocal named[99577]: loading configuration from '/etc/named.conf' Mar 09 20:30:02 np0005642945.novalocal named[99577]: unable to open '/etc/bind.keys'; using built-in keys instead Mar 09 20:30:02 np0005642945.novalocal named[99577]: looking for GeoIP2 databases in '/usr/share/GeoIP' Mar 09 20:30:02 np0005642945.novalocal named[99577]: opened GeoIP2 database '/usr/share/GeoIP/GeoLite2-Country.mmdb' Mar 09 20:30:02 np0005642945.novalocal named[99577]: opened GeoIP2 database '/usr/share/GeoIP/GeoLite2-City.mmdb' Mar 09 20:30:02 np0005642945.novalocal named[99577]: using default UDP/IPv4 port range: [32768, 60999] Mar 09 20:30:02 np0005642945.novalocal named[99577]: using default UDP/IPv6 port range: [32768, 60999] Mar 09 20:30:02 np0005642945.novalocal named[99577]: listening on IPv6 interface lo, ::1#5322 Mar 09 20:30:02 np0005642945.novalocal named[99577]: generating session key for dynamic DNS Mar 09 20:30:02 np0005642945.novalocal named[99577]: loading NZD zone count from '_default.nzd' for view '_default' Mar 09 20:30:02 np0005642945.novalocal named[99577]: NZD database '_default.nzd' contains 0 zones Mar 09 20:30:02 np0005642945.novalocal named[99577]: sizing zone task pool based on 5 zones Mar 09 20:30:02 np0005642945.novalocal named[99577]: loading NZD configs from '_default.nzd' for view '_default' Mar 09 20:30:02 np0005642945.novalocal named[99577]: set up managed keys zone for view _default, file 'managed-keys.bind' Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 10.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 16.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 17.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 18.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 19.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 20.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 21.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 22.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 23.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 24.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 25.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 26.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 27.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 28.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 29.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 30.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 31.172.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 168.192.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 64.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 65.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 66.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 67.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 68.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 69.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 70.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 71.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 72.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 73.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 74.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 75.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 76.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 77.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 78.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 79.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 80.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 81.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 82.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 83.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 84.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 85.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 86.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 87.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 88.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 89.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 90.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 91.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 92.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 93.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 94.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 95.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 96.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 97.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 98.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 99.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 100.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 101.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 102.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 103.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 104.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 105.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 106.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 107.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 108.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 109.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 110.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 111.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 112.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 113.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 114.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 115.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 116.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 117.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 118.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 119.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 120.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 121.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 122.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 123.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 124.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 125.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 126.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 127.100.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 127.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 254.169.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 2.0.192.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 100.51.198.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 113.0.203.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 255.255.255.255.IN-ADDR.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.IP6.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: D.F.IP6.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 8.E.F.IP6.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 9.E.F.IP6.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: A.E.F.IP6.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: B.E.F.IP6.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: 8.B.D.0.1.0.0.2.IP6.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: EMPTY.AS112.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: automatic empty zone: HOME.ARPA Mar 09 20:30:02 np0005642945.novalocal named[99577]: command channel listening on ::1#953 Mar 09 20:30:02 np0005642945.novalocal named[99577]: managed-keys-zone: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal named[99577]: zone 0.in-addr.arpa/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal named[99577]: zone 1.0.0.127.in-addr.arpa/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal named[99577]: zone localhost.localdomain/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal named[99577]: zone 1.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.ip6.arpa/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal named[99577]: zone localhost/IN: loaded serial 0 Mar 09 20:30:02 np0005642945.novalocal named[99577]: all zones loaded Mar 09 20:30:02 np0005642945.novalocal named[99577]: running Mar 09 20:30:02 np0005642945.novalocal systemd[1]: Started Berkeley Internet Name Domain (DNS). Mar 09 20:30:03 np0005642945.novalocal CROND[99543]: (keystone) CMDEND (keystone-manage fernet_rotate) Mar 09 20:30:03 np0005642945.novalocal systemd[1]: session-5.scope: Deactivated successfully. Mar 09 20:30:03 np0005642945.novalocal systemd[1]: session-5.scope: Consumed 1.624s CPU time. Mar 09 20:30:12 np0005642945.novalocal crontab[99668]: (root) LIST (root) Mar 09 20:30:12 np0005642945.novalocal crontab[99669]: (root) LIST (keystone) Mar 09 20:30:12 np0005642945.novalocal crontab[99670]: (root) LIST (glance) Mar 09 20:30:12 np0005642945.novalocal crontab[99671]: (root) LIST (nova) Mar 09 20:30:12 np0005642945.novalocal crontab[99672]: (root) LIST (heat) Mar 09 20:30:13 np0005642945.novalocal systemd[1]: Stopping User Manager for UID 163... Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Activating special unit Exit the Session... Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Stopped target Main User Target. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Stopped target Basic System. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Stopped target Paths. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Stopped target Sockets. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Stopped target Timers. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Stopped Daily Cleanup of User's Temporary Directories. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Closed D-Bus User Message Bus Socket. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Closed PipeWire PulseAudio. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Closed PipeWire Multimedia System Sockets. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Stopped Create User's Volatile Files and Directories. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Removed slice User Application Slice. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Reached target Shutdown. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Finished Exit the Session. Mar 09 20:30:13 np0005642945.novalocal systemd[99547]: Reached target Exit the Session. Mar 09 20:30:13 np0005642945.novalocal systemd[1]: user@163.service: Deactivated successfully. Mar 09 20:30:13 np0005642945.novalocal systemd[1]: Stopped User Manager for UID 163. Mar 09 20:30:13 np0005642945.novalocal systemd[1]: Stopping User Runtime Directory /run/user/163... Mar 09 20:30:13 np0005642945.novalocal systemd[1]: run-user-163.mount: Deactivated successfully. Mar 09 20:30:13 np0005642945.novalocal systemd[1]: user-runtime-dir@163.service: Deactivated successfully. Mar 09 20:30:13 np0005642945.novalocal systemd[1]: Stopped User Runtime Directory /run/user/163. Mar 09 20:30:13 np0005642945.novalocal systemd[1]: Removed slice User Slice of UID 163. Mar 09 20:30:13 np0005642945.novalocal systemd[1]: user-163.slice: Consumed 1.832s CPU time. Mar 09 20:30:16 np0005642945.novalocal runuser[99687]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:16 np0005642945.novalocal runuser[99687]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:17 np0005642945.novalocal runuser[99741]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:17 np0005642945.novalocal runuser[99741]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:17 np0005642945.novalocal runuser[99793]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:18 np0005642945.novalocal runuser[99793]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:18 np0005642945.novalocal runuser[99847]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:19 np0005642945.novalocal runuser[99847]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:19 np0005642945.novalocal runuser[99899]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:19 np0005642945.novalocal runuser[99899]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:20 np0005642945.novalocal runuser[99951]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:20 np0005642945.novalocal runuser[99951]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:20 np0005642945.novalocal runuser[100005]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:21 np0005642945.novalocal runuser[100005]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:21 np0005642945.novalocal runuser[100057]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:22 np0005642945.novalocal runuser[100057]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:22 np0005642945.novalocal runuser[100109]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:22 np0005642945.novalocal runuser[100109]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:23 np0005642945.novalocal runuser[100163]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:23 np0005642945.novalocal runuser[100163]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:23 np0005642945.novalocal runuser[100215]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:24 np0005642945.novalocal runuser[100215]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:25 np0005642945.novalocal runuser[100271]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:25 np0005642945.novalocal runuser[100271]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:25 np0005642945.novalocal runuser[100325]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:26 np0005642945.novalocal runuser[100325]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:28 np0005642945.novalocal runuser[100403]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:28 np0005642945.novalocal runuser[100403]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:28 np0005642945.novalocal runuser[100455]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:29 np0005642945.novalocal runuser[100455]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:30 np0005642945.novalocal runuser[100515]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:30 np0005642945.novalocal runuser[100515]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:30 np0005642945.novalocal runuser[100567]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:31 np0005642945.novalocal runuser[100567]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:31 np0005642945.novalocal runuser[100625]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:32 np0005642945.novalocal runuser[100625]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:32 np0005642945.novalocal runuser[100677]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:33 np0005642945.novalocal runuser[100677]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:33 np0005642945.novalocal runuser[100739]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:34 np0005642945.novalocal runuser[100739]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:34 np0005642945.novalocal runuser[100791]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:35 np0005642945.novalocal runuser[100791]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:36 np0005642945.novalocal runuser[100853]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:36 np0005642945.novalocal runuser[100853]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:36 np0005642945.novalocal runuser[100905]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:37 np0005642945.novalocal runuser[100905]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:37 np0005642945.novalocal systemd[1]: /usr/lib/systemd/system/openstack-barbican-api.service:15: Standard output type syslog is obsolete, automatically updating to journal. Please update your unit file, and consider removing the setting altogether. Mar 09 20:30:38 np0005642945.novalocal runuser[101001]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:38 np0005642945.novalocal runuser[101001]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:30:39 np0005642945.novalocal runuser[101053]: pam_unix(runuser:session): session opened for user rabbitmq(uid=987) by zuul-worker(uid=0) Mar 09 20:30:39 np0005642945.novalocal runuser[101053]: pam_unix(runuser:session): session closed for user rabbitmq Mar 09 20:31:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:31:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:31:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:32:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:32:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:32:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:33:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:33:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:33:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:33:39 np0005642945.novalocal sshd[45627]: Timeout before authentication for connection from 140.249.49.185 to 38.102.83.144, pid = 101145 Mar 09 20:34:02 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:34:02 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:34:02 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:34:34 np0005642945.novalocal sudo[55586]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:35 np0005642945.novalocal sudo[101952]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-reehywvaxwtmjtmxxxtwogfmnuurtegp ; WORKSPACE=/var/log/weirdo-project /usr/bin/python3' Mar 09 20:34:35 np0005642945.novalocal sudo[101952]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:34:35 np0005642945.novalocal python3[101954]: ansible-command Invoked with chdir=/tmp/puppet-openstack creates=/var/log/weirdo-project/logs _raw_params=./copy_logs.sh warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None executable=None removes=None stdin=None Mar 09 20:34:35 np0005642945.novalocal sudo[102078]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/barbican /var/log/weirdo-project/logs/etc/ Mar 09 20:34:35 np0005642945.novalocal sudo[102078]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:35 np0005642945.novalocal sudo[102078]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:35 np0005642945.novalocal sudo[102081]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/barbican /var/log/weirdo-project/logs Mar 09 20:34:35 np0005642945.novalocal sudo[102081]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:35 np0005642945.novalocal sudo[102081]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:35 np0005642945.novalocal sudo[102084]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/ceph /var/log/weirdo-project/logs/etc/ Mar 09 20:34:35 np0005642945.novalocal sudo[102084]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:35 np0005642945.novalocal sudo[102084]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:35 np0005642945.novalocal sudo[102087]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/designate /var/log/weirdo-project/logs/etc/ Mar 09 20:34:35 np0005642945.novalocal sudo[102087]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:35 np0005642945.novalocal sudo[102087]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:35 np0005642945.novalocal sudo[102090]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/designate /var/log/weirdo-project/logs Mar 09 20:34:35 np0005642945.novalocal sudo[102090]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:35 np0005642945.novalocal sudo[102090]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:35 np0005642945.novalocal sudo[102093]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/glance /var/log/weirdo-project/logs/etc/ Mar 09 20:34:35 np0005642945.novalocal sudo[102093]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:35 np0005642945.novalocal sudo[102093]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:35 np0005642945.novalocal sudo[102096]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/glance /var/log/weirdo-project/logs Mar 09 20:34:35 np0005642945.novalocal sudo[102096]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:35 np0005642945.novalocal sudo[102096]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:35 np0005642945.novalocal sudo[102099]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/heat /var/log/weirdo-project/logs/etc/ Mar 09 20:34:35 np0005642945.novalocal sudo[102099]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:35 np0005642945.novalocal sudo[102099]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102102]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/heat /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102102]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102102]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102105]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/horizon /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102105]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102105]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102108]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/keystone /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102108]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102108]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102111]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/keystone /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102111]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102111]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102114]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/magnum /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102114]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102114]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102117]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/magnum /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102117]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102117]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102120]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/mistral /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102120]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102120]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102123]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/mistral /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102123]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102123]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102126]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/neutron /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102126]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102126]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102129]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/neutron /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102129]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102129]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102132]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/nova /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102132]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102132]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102135]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/nova /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102135]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102135]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102138]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/ovn /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102138]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102138]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102141]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/ovn /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102141]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102141]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102144]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/placement /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102144]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102144]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102147]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/placement /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102147]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102147]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102150]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/tempest /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102150]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102150]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102153]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/trove /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102153]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102153]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102156]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/trove /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102156]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102156]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102159]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/puppet/puppet.conf /var/log/weirdo-project/logs/ Mar 09 20:34:36 np0005642945.novalocal sudo[102159]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102159]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102163]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/journalctl --no-pager Mar 09 20:34:36 np0005642945.novalocal sudo[102163]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102163]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102167]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/sysconfig/network-scripts /var/log/weirdo-project/logs/etc/sysconfig/ Mar 09 20:34:36 np0005642945.novalocal sudo[102167]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102167]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102170]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/rabbitmq /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102170]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102170]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102173]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/rabbitmq /var/log/weirdo-project/logs Mar 09 20:34:36 np0005642945.novalocal sudo[102173]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102173]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102176]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/my.cnf /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102176]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102176]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102179]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/my.cnf.d /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102179]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102179]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102182]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/mariadb /var/log/weirdo-project/logs/ Mar 09 20:34:36 np0005642945.novalocal sudo[102182]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102182]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102185]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/iscsi /var/log/weirdo-project/logs/etc/ Mar 09 20:34:36 np0005642945.novalocal sudo[102185]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102185]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102188]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /var/log/dstat.log /var/log/weirdo-project/logs/ Mar 09 20:34:36 np0005642945.novalocal sudo[102188]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102188]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102191]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /var/log/iostat.log /var/log/weirdo-project/logs/ Mar 09 20:34:36 np0005642945.novalocal sudo[102191]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102191]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:36 np0005642945.novalocal sudo[102194]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /var/log/iotop.log /var/log/weirdo-project/logs/ Mar 09 20:34:36 np0005642945.novalocal sudo[102194]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:36 np0005642945.novalocal sudo[102194]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102197]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/libvirt /var/log/weirdo-project/logs/ Mar 09 20:34:37 np0005642945.novalocal sudo[102197]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102197]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102200]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/virsh net-list --all Mar 09 20:34:37 np0005642945.novalocal sudo[102200]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102200]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102204]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/libvirt /var/log/weirdo-project/logs/etc/ Mar 09 20:34:37 np0005642945.novalocal sudo[102204]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102204]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102207]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/openvswitch /var/log/weirdo-project/logs/etc/ Mar 09 20:34:37 np0005642945.novalocal sudo[102207]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102207]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102210]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/openvswitch /var/log/weirdo-project/logs/ Mar 09 20:34:37 np0005642945.novalocal sudo[102210]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102210]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102214]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/ovn-nbctl show Mar 09 20:34:37 np0005642945.novalocal sudo[102214]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102214]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102217]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/ovn-nbctl get-connection Mar 09 20:34:37 np0005642945.novalocal sudo[102217]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102217]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102220]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/ovn-nbctl get-ssl Mar 09 20:34:37 np0005642945.novalocal sudo[102220]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102220]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102223]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/ovn-sbctl show Mar 09 20:34:37 np0005642945.novalocal sudo[102223]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102223]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102226]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/ovn-sbctl get-connection Mar 09 20:34:37 np0005642945.novalocal sudo[102226]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102226]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102229]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/ovn-sbctl get-ssl Mar 09 20:34:37 np0005642945.novalocal sudo[102229]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102229]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102233]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/sysconfig/ovn-northd /var/log/weirdo-project/logs/etc/sysconfig/ Mar 09 20:34:37 np0005642945.novalocal sudo[102233]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102233]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102237]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/sysconfig/ovn-controller /var/log/weirdo-project/logs/etc/sysconfig/ Mar 09 20:34:37 np0005642945.novalocal sudo[102237]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102237]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102240]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/sudoers.d /var/log/weirdo-project/logs/ Mar 09 20:34:37 np0005642945.novalocal sudo[102240]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102240]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102243]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/sudoers /var/log/weirdo-project/logs/sudoers.txt Mar 09 20:34:37 np0005642945.novalocal sudo[102243]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102243]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102247]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/httpd/conf/httpd.conf /etc/httpd/conf/magic /etc/httpd/conf/ports.conf /var/log/weirdo-project/logs/etc/httpd/conf/ Mar 09 20:34:37 np0005642945.novalocal sudo[102247]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102247]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102251]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/httpd/conf.d/10-barbican_wsgi.conf /etc/httpd/conf.d/10-designate_wsgi.conf /etc/httpd/conf.d/10-heat_api_cfn_wsgi.conf /etc/httpd/conf.d/10-heat_api_wsgi.conf /etc/httpd/conf.d/10-keystone_wsgi.conf /etc/httpd/conf.d/10-mistral_wsgi.conf /etc/httpd/conf.d/10-nova_api_wsgi.conf /etc/httpd/conf.d/10-nova_metadata_wsgi.conf /etc/httpd/conf.d/10-placement_wsgi.conf /etc/httpd/conf.d/10-trove_wsgi.conf /etc/httpd/conf.d/15-horizon_ssl_vhost.conf /etc/httpd/conf.d/15-horizon_vhost.conf /etc/httpd/conf.d/openstack-dashboard.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/ Mar 09 20:34:37 np0005642945.novalocal sudo[102251]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102251]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102255]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/httpd/conf.modules.d/access_compat.load /etc/httpd/conf.modules.d/actions.load /etc/httpd/conf.modules.d/alias.conf /etc/httpd/conf.modules.d/alias.load /etc/httpd/conf.modules.d/auth_basic.load /etc/httpd/conf.modules.d/auth_digest.load /etc/httpd/conf.modules.d/authn_anon.load /etc/httpd/conf.modules.d/authn_core.load /etc/httpd/conf.modules.d/authn_dbm.load /etc/httpd/conf.modules.d/authn_file.load /etc/httpd/conf.modules.d/authz_core.load /etc/httpd/conf.modules.d/authz_dbm.load /etc/httpd/conf.modules.d/authz_groupfile.load /etc/httpd/conf.modules.d/authz_host.load /etc/httpd/conf.modules.d/authz_owner.load /etc/httpd/conf.modules.d/authz_user.load /etc/httpd/conf.modules.d/autoindex.conf /etc/httpd/conf.modules.d/autoindex.load /etc/httpd/conf.modules.d/cache.load /etc/httpd/conf.modules.d/cgi.load /etc/httpd/conf.modules.d/dav_fs.conf /etc/httpd/conf.modules.d/dav_fs.load Mar 09 20:34:37 np0005642945.novalocal sudo[102255]: root : (command continued) /etc/httpd/conf.modules.d/dav.load /etc/httpd/conf.modules.d/deflate.conf /etc/httpd/conf.modules.d/deflate.load /etc/httpd/conf.modules.d/dir.conf /etc/httpd/conf.modules.d/dir.load /etc/httpd/conf.modules.d/env.load /etc/httpd/conf.modules.d/expires.load /etc/httpd/conf.modules.d/ext_filter.load /etc/httpd/conf.modules.d/filter.load /etc/httpd/conf.modules.d/headers.load /etc/httpd/conf.modules.d/include.load /etc/httpd/conf.modules.d/log_config.load /etc/httpd/conf.modules.d/logio.load /etc/httpd/conf.modules.d/mime.conf /etc/httpd/conf.modules.d/mime.load /etc/httpd/conf.modules.d/mime_magic.conf /etc/httpd/conf.modules.d/mime_magic.load /etc/httpd/conf.modules.d/negotiation.conf /etc/httpd/conf.modules.d/negotiation.load /etc/httpd/conf.modules.d/prefork.conf /etc/httpd/conf.modules.d/prefork.load /etc/httpd/conf.modules.d/rewrite.load /etc/httpd/conf.modules.d/setenvif.conf /etc/httpd/conf.modules.d/setenvif.load Mar 09 20:34:37 np0005642945.novalocal sudo[102255]: root : (command continued) /etc/httpd/conf.modules.d/socache_shmcb.load /etc/httpd/conf.modules.d/speling.load /etc/httpd/conf.modules.d/ssl.conf /etc/httpd/conf.modules.d/ssl.load /etc/httpd/conf.modules.d/substitute.load /etc/httpd/conf.modules.d/suexec.load /etc/httpd/conf.modules.d/systemd.load /etc/httpd/conf.modules.d/unixd.load /etc/httpd/conf.modules.d/usertrack.load /etc/httpd/conf.modules.d/version.load /etc/httpd/conf.modules.d/vhost_alias.load /etc/httpd/conf.modules.d/wsgi.conf /etc/httpd/conf.modules.d/wsgi.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/ Mar 09 20:34:37 np0005642945.novalocal sudo[102255]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102255]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102258]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/log/httpd /var/log/weirdo-project/logs/apache Mar 09 20:34:37 np0005642945.novalocal sudo[102258]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102258]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102261]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /var/log/redis/redis.log /var/log/weirdo-project/logs/redis.log.txt Mar 09 20:34:37 np0005642945.novalocal sudo[102261]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102261]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102264]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/redis /var/log/weirdo-project/logs/etc/redis Mar 09 20:34:37 np0005642945.novalocal sudo[102264]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102264]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102267]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /var/log/audit/audit.log /var/log/weirdo-project/logs/audit.log.txt Mar 09 20:34:37 np0005642945.novalocal sudo[102267]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102267]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102270]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /var/spool/cron /var/log/weirdo-project/logs/ Mar 09 20:34:37 np0005642945.novalocal sudo[102270]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102270]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102273]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /tmp/openstack/tempest/etc/tempest.conf /var/log/weirdo-project/logs/tempest.conf.txt Mar 09 20:34:37 np0005642945.novalocal sudo[102273]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102273]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102276]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/openstack-dashboard /var/log/weirdo-project/logs/etc/openstack-dashboard Mar 09 20:34:37 np0005642945.novalocal sudo[102276]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102276]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102282]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/cinder_policy.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/cinder_policy.yaml.txt Mar 09 20:34:37 np0005642945.novalocal sudo[102282]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102282]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102291]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt Mar 09 20:34:37 np0005642945.novalocal sudo[102291]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102291]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102322]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/enabled /var/log/weirdo-project/logs/etc/openstack-dashboard/enabled.txt Mar 09 20:34:37 np0005642945.novalocal sudo[102322]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102322]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:37 np0005642945.novalocal sudo[102325]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/glance_policy.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/glance_policy.yaml.txt Mar 09 20:34:37 np0005642945.novalocal sudo[102325]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:37 np0005642945.novalocal sudo[102325]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:38 np0005642945.novalocal sudo[102328]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/heat_policy.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/heat_policy.yaml.txt Mar 09 20:34:38 np0005642945.novalocal sudo[102328]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:38 np0005642945.novalocal sudo[102328]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:38 np0005642945.novalocal sudo[102331]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/keystone_policy.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/keystone_policy.yaml.txt Mar 09 20:34:38 np0005642945.novalocal sudo[102331]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:38 np0005642945.novalocal sudo[102331]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:38 np0005642945.novalocal sudo[102334]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.txt Mar 09 20:34:38 np0005642945.novalocal sudo[102334]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:38 np0005642945.novalocal sudo[102334]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:38 np0005642945.novalocal sudo[102337]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt Mar 09 20:34:38 np0005642945.novalocal sudo[102337]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:38 np0005642945.novalocal sudo[102337]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:38 np0005642945.novalocal sudo[102340]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/neutron_policy.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/neutron_policy.yaml.txt Mar 09 20:34:38 np0005642945.novalocal sudo[102340]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:38 np0005642945.novalocal sudo[102340]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:38 np0005642945.novalocal sudo[102343]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/nova_policy.d /var/log/weirdo-project/logs/etc/openstack-dashboard/nova_policy.d.txt Mar 09 20:34:38 np0005642945.novalocal sudo[102343]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:38 np0005642945.novalocal sudo[102343]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:38 np0005642945.novalocal sudo[102346]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/nova_policy.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/nova_policy.yaml.txt Mar 09 20:34:38 np0005642945.novalocal sudo[102346]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:38 np0005642945.novalocal sudo[102346]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:38 np0005642945.novalocal sudo[102349]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/ssl /var/log/weirdo-project/logs/etc/openstack-dashboard/ssl.txt Mar 09 20:34:38 np0005642945.novalocal sudo[102349]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:38 np0005642945.novalocal sudo[102349]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:38 np0005642945.novalocal sudo[102358]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/dnf repolist -v Mar 09 20:34:38 np0005642945.novalocal sudo[102358]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:40 np0005642945.novalocal sudo[102358]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:40 np0005642945.novalocal sudo[102361]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/dnf list installed Mar 09 20:34:40 np0005642945.novalocal sudo[102361]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:41 np0005642945.novalocal sudo[102361]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:41 np0005642945.novalocal sudo[102364]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/yum.repos.d /var/log/weirdo-project/logs/etc/yum.repos.d Mar 09 20:34:41 np0005642945.novalocal sudo[102364]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:41 np0005642945.novalocal sudo[102364]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:41 np0005642945.novalocal sudo[102368]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/dnf module list Mar 09 20:34:41 np0005642945.novalocal sudo[102368]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:41 np0005642945.novalocal sudo[102368]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:41 np0005642945.novalocal sudo[102372]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /var/log/dnf.log /var/log/weirdo-project/logs/dnf Mar 09 20:34:41 np0005642945.novalocal sudo[102372]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:41 np0005642945.novalocal sudo[102372]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:41 np0005642945.novalocal sudo[102375]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /var/log/dnf.rpm.log /var/log/weirdo-project/logs/dnf Mar 09 20:34:41 np0005642945.novalocal sudo[102375]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102375]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102381]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/passwd /var/log/weirdo-project/logs/etc Mar 09 20:34:42 np0005642945.novalocal sudo[102381]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102381]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102384]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/group /var/log/weirdo-project/logs/etc Mar 09 20:34:42 np0005642945.novalocal sudo[102384]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102384]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102387]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /root/openrc /var/log/weirdo-project/logs/openrc.txt Mar 09 20:34:42 np0005642945.novalocal sudo[102387]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102387]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102390]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/chmod 777 /var/log/weirdo-project/logs/openrc.txt Mar 09 20:34:42 np0005642945.novalocal sudo[102390]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102390]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102393]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp -r /etc/openstack /var/log/weirdo-project/logs/etc Mar 09 20:34:42 np0005642945.novalocal sudo[102393]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102393]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102396]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/chmod 777 /var/log/weirdo-project/logs/etc/openstack/puppet/admin-clouds.yaml Mar 09 20:34:42 np0005642945.novalocal sudo[102396]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102396]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102403]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/ps -eo user,pid,ppid,lwp,%cpu,%mem,size,rss,cmd Mar 09 20:34:42 np0005642945.novalocal sudo[102403]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102403]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102406]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/sbin/ip -d address Mar 09 20:34:42 np0005642945.novalocal sudo[102406]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102406]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102412]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/ovs-vsctl show Mar 09 20:34:42 np0005642945.novalocal sudo[102412]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102412]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102415]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/ovs-vsctl list open_vswitch Mar 09 20:34:42 np0005642945.novalocal sudo[102415]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102415]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102418]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/netstat -tulpn Mar 09 20:34:42 np0005642945.novalocal sudo[102418]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:42 np0005642945.novalocal sudo[102418]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:42 np0005642945.novalocal sudo[102421]: root : PWD=/tmp/puppet-openstack ; USER=root ; ENV=LC_CTYPE=C SYSTEMD_COLORS=false ; COMMAND=/bin/systemctl status --all --no-pager Mar 09 20:34:42 np0005642945.novalocal sudo[102421]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102421]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102424]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/sbin/iptables -t raw -vnxL Mar 09 20:34:44 np0005642945.novalocal sudo[102424]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102424]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102427]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/sbin/iptables -t filter -vnxL Mar 09 20:34:44 np0005642945.novalocal sudo[102427]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102427]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102430]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/sbin/iptables -t nat -vnxL Mar 09 20:34:44 np0005642945.novalocal sudo[102430]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102430]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102433]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/sbin/iptables -t mangle -vnxL Mar 09 20:34:44 np0005642945.novalocal sudo[102433]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102433]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102436]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/cp /etc/fstab /var/log/weirdo-project/logs/etc/ Mar 09 20:34:44 np0005642945.novalocal sudo[102436]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102436]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102439]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mount Mar 09 20:34:44 np0005642945.novalocal sudo[102439]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102439]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102442]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/sbin/losetup -al Mar 09 20:34:44 np0005642945.novalocal sudo[102442]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102442]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102445]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/sbin/pvs Mar 09 20:34:44 np0005642945.novalocal sudo[102445]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102445]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102448]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/sbin/vgs Mar 09 20:34:44 np0005642945.novalocal sudo[102448]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102448]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:44 np0005642945.novalocal sudo[102451]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/sbin/lvs Mar 09 20:34:44 np0005642945.novalocal sudo[102451]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:34:44 np0005642945.novalocal sudo[102451]: pam_unix(sudo:session): session closed for user root Mar 09 20:34:50 np0005642945.novalocal sudo[102461]: root : PWD=/tmp/puppet-openstack ; USER=nova ; COMMAND=/bin/nova-manage cell_v2 list_cells --verbose Mar 09 20:34:50 np0005642945.novalocal sudo[102461]: pam_unix(sudo:session): session opened for user nova(uid=162) by zuul-worker(uid=0) Mar 09 20:34:53 np0005642945.novalocal sudo[102461]: pam_unix(sudo:session): session closed for user nova Mar 09 20:34:53 np0005642945.novalocal sudo[102467]: root : PWD=/tmp/puppet-openstack ; USER=nova ; COMMAND=/bin/nova-manage cell_v2 list_hosts Mar 09 20:34:53 np0005642945.novalocal sudo[102467]: pam_unix(sudo:session): session opened for user nova(uid=162) by zuul-worker(uid=0) Mar 09 20:34:55 np0005642945.novalocal sudo[102467]: pam_unix(sudo:session): session closed for user nova Mar 09 20:35:05 np0005642945.novalocal systemd[1]: Starting system activity accounting tool... Mar 09 20:35:05 np0005642945.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Mar 09 20:35:05 np0005642945.novalocal systemd[1]: Finished system activity accounting tool. Mar 09 20:35:08 np0005642945.novalocal designate-central[95420]: /usr/lib/python3.9/site-packages/oslo_policy/policy.py:1129: UserWarning: Policy "find_service_statuses": "role:reader and system_scope:all" failed scope check. The token used to make the request was project scoped but the policy requires ['system'] scope. This behavior may change in the future where using the intended scope is required Mar 09 20:35:08 np0005642945.novalocal designate-central[95420]: warnings.warn(msg) Mar 09 20:35:26 np0005642945.novalocal sudo[102511]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/find /var/log/weirdo-project/logs -type d -execdir sudo chmod 755 {} ; Mar 09 20:35:26 np0005642945.novalocal sudo[102511]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102514]: root : PWD=/var/log/weirdo-project ; USER=root ; COMMAND=/bin/chmod 755 ./logs Mar 09 20:35:26 np0005642945.novalocal sudo[102514]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102514]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102517]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./etc Mar 09 20:35:26 np0005642945.novalocal sudo[102517]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102517]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102520]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./barbican Mar 09 20:35:26 np0005642945.novalocal sudo[102520]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102520]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102523]: root : PWD=/var/log/weirdo-project/logs/etc/barbican ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:26 np0005642945.novalocal sudo[102523]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102523]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102526]: root : PWD=/var/log/weirdo-project/logs/etc/barbican/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:26 np0005642945.novalocal sudo[102526]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102526]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102529]: root : PWD=/var/log/weirdo-project/logs/etc/barbican ; USER=root ; COMMAND=/bin/chmod 755 ./vassals Mar 09 20:35:26 np0005642945.novalocal sudo[102529]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102529]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102532]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./ceph Mar 09 20:35:26 np0005642945.novalocal sudo[102532]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102532]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102535]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./designate Mar 09 20:35:26 np0005642945.novalocal sudo[102535]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102535]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102538]: root : PWD=/var/log/weirdo-project/logs/etc/designate ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:26 np0005642945.novalocal sudo[102538]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102538]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102541]: root : PWD=/var/log/weirdo-project/logs/etc/designate/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:26 np0005642945.novalocal sudo[102541]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102541]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102544]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./glance Mar 09 20:35:26 np0005642945.novalocal sudo[102544]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102544]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102547]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:26 np0005642945.novalocal sudo[102547]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102547]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102550]: root : PWD=/var/log/weirdo-project/logs/etc/glance/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:26 np0005642945.novalocal sudo[102550]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102550]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:26 np0005642945.novalocal sudo[102553]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 755 ./metadefs Mar 09 20:35:26 np0005642945.novalocal sudo[102553]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:26 np0005642945.novalocal sudo[102553]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102556]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 755 ./rootwrap.d Mar 09 20:35:27 np0005642945.novalocal sudo[102556]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102556]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102559]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./heat Mar 09 20:35:27 np0005642945.novalocal sudo[102559]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102559]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102562]: root : PWD=/var/log/weirdo-project/logs/etc/heat ; USER=root ; COMMAND=/bin/chmod 755 ./environment.d Mar 09 20:35:27 np0005642945.novalocal sudo[102562]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102562]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102565]: root : PWD=/var/log/weirdo-project/logs/etc/heat ; USER=root ; COMMAND=/bin/chmod 755 ./templates Mar 09 20:35:27 np0005642945.novalocal sudo[102565]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102565]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102568]: root : PWD=/var/log/weirdo-project/logs/etc/heat ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:27 np0005642945.novalocal sudo[102568]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102568]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102571]: root : PWD=/var/log/weirdo-project/logs/etc/heat/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:27 np0005642945.novalocal sudo[102571]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102571]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102574]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./keystone Mar 09 20:35:27 np0005642945.novalocal sudo[102574]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102574]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102577]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:27 np0005642945.novalocal sudo[102577]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102577]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102580]: root : PWD=/var/log/weirdo-project/logs/etc/keystone/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:27 np0005642945.novalocal sudo[102580]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102580]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102583]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 755 ./fernet-keys Mar 09 20:35:27 np0005642945.novalocal sudo[102583]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102583]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102586]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 755 ./credential-keys Mar 09 20:35:27 np0005642945.novalocal sudo[102586]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102586]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102589]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 755 ./policy.d Mar 09 20:35:27 np0005642945.novalocal sudo[102589]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102589]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102592]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./magnum Mar 09 20:35:27 np0005642945.novalocal sudo[102592]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102592]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102595]: root : PWD=/var/log/weirdo-project/logs/etc/magnum ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:27 np0005642945.novalocal sudo[102595]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102595]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102598]: root : PWD=/var/log/weirdo-project/logs/etc/magnum/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:27 np0005642945.novalocal sudo[102598]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102598]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102601]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./mistral Mar 09 20:35:27 np0005642945.novalocal sudo[102601]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102601]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102604]: root : PWD=/var/log/weirdo-project/logs/etc/mistral ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:27 np0005642945.novalocal sudo[102604]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102604]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102607]: root : PWD=/var/log/weirdo-project/logs/etc/mistral/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:27 np0005642945.novalocal sudo[102607]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102607]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102610]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./neutron Mar 09 20:35:27 np0005642945.novalocal sudo[102610]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102610]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102613]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 755 ./conf.d Mar 09 20:35:27 np0005642945.novalocal sudo[102613]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102613]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102616]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 755 ./neutron-ovn-metadata-agent Mar 09 20:35:27 np0005642945.novalocal sudo[102616]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102616]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102619]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 755 ./common Mar 09 20:35:27 np0005642945.novalocal sudo[102619]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102619]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102622]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 755 ./neutron-dhcp-agent Mar 09 20:35:27 np0005642945.novalocal sudo[102622]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102622]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102625]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 755 ./neutron-l3-agent Mar 09 20:35:27 np0005642945.novalocal sudo[102625]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102625]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102628]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 755 ./neutron-linuxbridge-cleanup Mar 09 20:35:27 np0005642945.novalocal sudo[102628]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102628]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102631]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 755 ./neutron-metadata-agent Mar 09 20:35:27 np0005642945.novalocal sudo[102631]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102631]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102634]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 755 ./neutron-netns-cleanup Mar 09 20:35:27 np0005642945.novalocal sudo[102634]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102634]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102637]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 755 ./neutron-ovs-cleanup Mar 09 20:35:27 np0005642945.novalocal sudo[102637]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102637]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102640]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 755 ./neutron-server Mar 09 20:35:27 np0005642945.novalocal sudo[102640]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102640]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102643]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 755 ./plugins Mar 09 20:35:27 np0005642945.novalocal sudo[102643]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102643]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102646]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/plugins ; USER=root ; COMMAND=/bin/chmod 755 ./networking-ovn Mar 09 20:35:27 np0005642945.novalocal sudo[102646]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102646]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102649]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/plugins ; USER=root ; COMMAND=/bin/chmod 755 ./ml2 Mar 09 20:35:27 np0005642945.novalocal sudo[102649]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102649]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102652]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:27 np0005642945.novalocal sudo[102652]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102652]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102655]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:27 np0005642945.novalocal sudo[102655]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102655]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102658]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 755 ./kill_scripts Mar 09 20:35:27 np0005642945.novalocal sudo[102658]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102658]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102661]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./nova Mar 09 20:35:27 np0005642945.novalocal sudo[102661]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102661]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102664]: root : PWD=/var/log/weirdo-project/logs/etc/nova ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:27 np0005642945.novalocal sudo[102664]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102664]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:27 np0005642945.novalocal sudo[102667]: root : PWD=/var/log/weirdo-project/logs/etc/nova/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:27 np0005642945.novalocal sudo[102667]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:27 np0005642945.novalocal sudo[102667]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102670]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./ovn Mar 09 20:35:28 np0005642945.novalocal sudo[102670]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102670]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102673]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./placement Mar 09 20:35:28 np0005642945.novalocal sudo[102673]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102673]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102676]: root : PWD=/var/log/weirdo-project/logs/etc/placement ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:28 np0005642945.novalocal sudo[102676]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102676]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102679]: root : PWD=/var/log/weirdo-project/logs/etc/placement/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:28 np0005642945.novalocal sudo[102679]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102679]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102682]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./tempest Mar 09 20:35:28 np0005642945.novalocal sudo[102682]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102682]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102685]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./trove Mar 09 20:35:28 np0005642945.novalocal sudo[102685]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102685]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102688]: root : PWD=/var/log/weirdo-project/logs/etc/trove ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:28 np0005642945.novalocal sudo[102688]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102688]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102691]: root : PWD=/var/log/weirdo-project/logs/etc/trove/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:28 np0005642945.novalocal sudo[102691]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102691]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102694]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./sysconfig Mar 09 20:35:28 np0005642945.novalocal sudo[102694]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102694]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102697]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig ; USER=root ; COMMAND=/bin/chmod 755 ./network-scripts Mar 09 20:35:28 np0005642945.novalocal sudo[102697]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102697]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102700]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./rabbitmq Mar 09 20:35:28 np0005642945.novalocal sudo[102700]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102700]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102703]: root : PWD=/var/log/weirdo-project/logs/etc/rabbitmq ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:28 np0005642945.novalocal sudo[102703]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102703]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102706]: root : PWD=/var/log/weirdo-project/logs/etc/rabbitmq/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:28 np0005642945.novalocal sudo[102706]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102706]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102709]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./my.cnf.d Mar 09 20:35:28 np0005642945.novalocal sudo[102709]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102709]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102712]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./iscsi Mar 09 20:35:28 np0005642945.novalocal sudo[102712]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102712]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102715]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./libvirt Mar 09 20:35:28 np0005642945.novalocal sudo[102715]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102715]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102718]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 755 ./secrets Mar 09 20:35:28 np0005642945.novalocal sudo[102718]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102718]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102721]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 755 ./storage Mar 09 20:35:28 np0005642945.novalocal sudo[102721]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102721]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102724]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/storage ; USER=root ; COMMAND=/bin/chmod 755 ./autostart Mar 09 20:35:28 np0005642945.novalocal sudo[102724]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102724]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102727]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 755 ./qemu Mar 09 20:35:28 np0005642945.novalocal sudo[102727]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102727]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102730]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/qemu ; USER=root ; COMMAND=/bin/chmod 755 ./autostart Mar 09 20:35:28 np0005642945.novalocal sudo[102730]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102730]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102733]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/qemu ; USER=root ; COMMAND=/bin/chmod 755 ./networks Mar 09 20:35:28 np0005642945.novalocal sudo[102733]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102733]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102736]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/qemu/networks ; USER=root ; COMMAND=/bin/chmod 755 ./autostart Mar 09 20:35:28 np0005642945.novalocal sudo[102736]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102736]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102739]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 755 ./nwfilter Mar 09 20:35:28 np0005642945.novalocal sudo[102739]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102739]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102742]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./openvswitch Mar 09 20:35:28 np0005642945.novalocal sudo[102742]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102742]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102745]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./httpd Mar 09 20:35:28 np0005642945.novalocal sudo[102745]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102745]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102748]: root : PWD=/var/log/weirdo-project/logs/etc/httpd ; USER=root ; COMMAND=/bin/chmod 755 ./conf Mar 09 20:35:28 np0005642945.novalocal sudo[102748]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102748]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102751]: root : PWD=/var/log/weirdo-project/logs/etc/httpd ; USER=root ; COMMAND=/bin/chmod 755 ./conf.d Mar 09 20:35:28 np0005642945.novalocal sudo[102751]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102751]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102754]: root : PWD=/var/log/weirdo-project/logs/etc/httpd ; USER=root ; COMMAND=/bin/chmod 755 ./conf.modules.d Mar 09 20:35:28 np0005642945.novalocal sudo[102754]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102754]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102757]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./redis Mar 09 20:35:28 np0005642945.novalocal sudo[102757]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102757]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102760]: root : PWD=/var/log/weirdo-project/logs/etc/redis ; USER=root ; COMMAND=/bin/chmod 755 ./ssl Mar 09 20:35:28 np0005642945.novalocal sudo[102760]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102760]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102763]: root : PWD=/var/log/weirdo-project/logs/etc/redis/ssl ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:28 np0005642945.novalocal sudo[102763]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102763]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102766]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./openstack-dashboard Mar 09 20:35:28 np0005642945.novalocal sudo[102766]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102766]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102769]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 755 ./default_policies.txt Mar 09 20:35:28 np0005642945.novalocal sudo[102769]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102769]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:28 np0005642945.novalocal sudo[102772]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 755 ./enabled.txt Mar 09 20:35:28 np0005642945.novalocal sudo[102772]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:28 np0005642945.novalocal sudo[102772]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102775]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 755 ./local_settings.d.txt Mar 09 20:35:29 np0005642945.novalocal sudo[102775]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102775]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102778]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 755 ./nova_policy.d.txt Mar 09 20:35:29 np0005642945.novalocal sudo[102778]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102778]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102781]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 755 ./ssl.txt Mar 09 20:35:29 np0005642945.novalocal sudo[102781]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102781]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102784]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/ssl.txt ; USER=root ; COMMAND=/bin/chmod 755 ./private Mar 09 20:35:29 np0005642945.novalocal sudo[102784]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102784]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102787]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./yum.repos.d Mar 09 20:35:29 np0005642945.novalocal sudo[102787]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102787]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102790]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 755 ./openstack Mar 09 20:35:29 np0005642945.novalocal sudo[102790]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102790]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102793]: root : PWD=/var/log/weirdo-project/logs/etc/openstack ; USER=root ; COMMAND=/bin/chmod 755 ./puppet Mar 09 20:35:29 np0005642945.novalocal sudo[102793]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102793]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102796]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./barbican Mar 09 20:35:29 np0005642945.novalocal sudo[102796]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102796]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102799]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./designate Mar 09 20:35:29 np0005642945.novalocal sudo[102799]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102799]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102802]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./glance Mar 09 20:35:29 np0005642945.novalocal sudo[102802]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102802]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102805]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./heat Mar 09 20:35:29 np0005642945.novalocal sudo[102805]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102805]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102808]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./horizon Mar 09 20:35:29 np0005642945.novalocal sudo[102808]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102808]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102811]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./keystone Mar 09 20:35:29 np0005642945.novalocal sudo[102811]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102811]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102814]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./magnum Mar 09 20:35:29 np0005642945.novalocal sudo[102814]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102814]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102817]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./mistral Mar 09 20:35:29 np0005642945.novalocal sudo[102817]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102817]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102820]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./neutron Mar 09 20:35:29 np0005642945.novalocal sudo[102820]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102820]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102823]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./nova Mar 09 20:35:29 np0005642945.novalocal sudo[102823]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102823]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102826]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./ovn Mar 09 20:35:29 np0005642945.novalocal sudo[102826]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102826]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102829]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./placement Mar 09 20:35:29 np0005642945.novalocal sudo[102829]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102829]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102832]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./trove Mar 09 20:35:29 np0005642945.novalocal sudo[102832]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102832]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102835]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./rabbitmq Mar 09 20:35:29 np0005642945.novalocal sudo[102835]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102835]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102838]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./mariadb Mar 09 20:35:29 np0005642945.novalocal sudo[102838]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102838]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102841]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./libvirt Mar 09 20:35:29 np0005642945.novalocal sudo[102841]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102841]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102844]: root : PWD=/var/log/weirdo-project/logs/libvirt ; USER=root ; COMMAND=/bin/chmod 755 ./qemu Mar 09 20:35:29 np0005642945.novalocal sudo[102844]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102844]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102848]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./openvswitch Mar 09 20:35:29 np0005642945.novalocal sudo[102848]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102848]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102851]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./sudoers.d Mar 09 20:35:29 np0005642945.novalocal sudo[102851]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102851]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102854]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./apache Mar 09 20:35:29 np0005642945.novalocal sudo[102854]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102854]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102857]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./cron Mar 09 20:35:29 np0005642945.novalocal sudo[102857]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102857]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102860]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./dnf Mar 09 20:35:29 np0005642945.novalocal sudo[102860]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102860]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102863]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 755 ./openstack_resources Mar 09 20:35:29 np0005642945.novalocal sudo[102863]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102863]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102511]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102866]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/find /var/log/weirdo-project/logs -type f -execdir sudo chmod 644 {} ; Mar 09 20:35:29 np0005642945.novalocal sudo[102866]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102869]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./puppet-20260309_202910.log Mar 09 20:35:29 np0005642945.novalocal sudo[102869]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102869]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102872]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./puppet.log Mar 09 20:35:29 np0005642945.novalocal sudo[102872]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102872]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102875]: root : PWD=/var/log/weirdo-project/logs/etc/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./barbican.conf Mar 09 20:35:29 np0005642945.novalocal sudo[102875]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102875]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102878]: root : PWD=/var/log/weirdo-project/logs/etc/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./api_audit_map.conf Mar 09 20:35:29 np0005642945.novalocal sudo[102878]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102878]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102881]: root : PWD=/var/log/weirdo-project/logs/etc/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./barbican-api-paste.ini Mar 09 20:35:29 np0005642945.novalocal sudo[102881]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102881]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102884]: root : PWD=/var/log/weirdo-project/logs/etc/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./barbican-functional.conf Mar 09 20:35:29 np0005642945.novalocal sudo[102884]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102884]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102887]: root : PWD=/var/log/weirdo-project/logs/etc/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./gunicorn-config.py Mar 09 20:35:29 np0005642945.novalocal sudo[102887]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102887]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102890]: root : PWD=/var/log/weirdo-project/logs/etc/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:29 np0005642945.novalocal sudo[102890]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102890]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:29 np0005642945.novalocal sudo[102893]: root : PWD=/var/log/weirdo-project/logs/etc/barbican/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:29 np0005642945.novalocal sudo[102893]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:29 np0005642945.novalocal sudo[102893]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102896]: root : PWD=/var/log/weirdo-project/logs/etc/barbican/vassals ; USER=root ; COMMAND=/bin/chmod 644 ./barbican-api.ini Mar 09 20:35:30 np0005642945.novalocal sudo[102896]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102896]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102899]: root : PWD=/var/log/weirdo-project/logs/etc/designate/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:30 np0005642945.novalocal sudo[102899]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102899]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102902]: root : PWD=/var/log/weirdo-project/logs/etc/designate ; USER=root ; COMMAND=/bin/chmod 644 ./designate.conf Mar 09 20:35:30 np0005642945.novalocal sudo[102902]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102902]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102905]: root : PWD=/var/log/weirdo-project/logs/etc/designate ; USER=root ; COMMAND=/bin/chmod 644 ./rootwrap.conf Mar 09 20:35:30 np0005642945.novalocal sudo[102905]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102905]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102908]: root : PWD=/var/log/weirdo-project/logs/etc/designate ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:30 np0005642945.novalocal sudo[102908]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102908]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102911]: root : PWD=/var/log/weirdo-project/logs/etc/designate ; USER=root ; COMMAND=/bin/chmod 644 ./api-paste.ini Mar 09 20:35:30 np0005642945.novalocal sudo[102911]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102911]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102914]: root : PWD=/var/log/weirdo-project/logs/etc/designate ; USER=root ; COMMAND=/bin/chmod 644 ./pools.yaml Mar 09 20:35:30 np0005642945.novalocal sudo[102914]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102914]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102917]: root : PWD=/var/log/weirdo-project/logs/etc/glance/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:30 np0005642945.novalocal sudo[102917]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102917]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102920]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 644 ./glance-api-paste.ini Mar 09 20:35:30 np0005642945.novalocal sudo[102920]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102920]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102923]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 644 ./glance-api.conf Mar 09 20:35:30 np0005642945.novalocal sudo[102923]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102923]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102926]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 644 ./glance-cache.conf Mar 09 20:35:30 np0005642945.novalocal sudo[102926]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102926]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102929]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 644 ./glance-image-import.conf Mar 09 20:35:30 np0005642945.novalocal sudo[102929]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102929]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102932]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 644 ./glance-scrubber.conf Mar 09 20:35:30 np0005642945.novalocal sudo[102932]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102932]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102935]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 644 ./glance-swift.conf Mar 09 20:35:30 np0005642945.novalocal sudo[102935]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102935]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102938]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 644 ./rootwrap.conf Mar 09 20:35:30 np0005642945.novalocal sudo[102938]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102938]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102941]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 644 ./schema-image.json Mar 09 20:35:30 np0005642945.novalocal sudo[102941]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102941]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102944]: root : PWD=/var/log/weirdo-project/logs/etc/glance ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:30 np0005642945.novalocal sudo[102944]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102944]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102947]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./cim-processor-allocation-setting-data.json Mar 09 20:35:30 np0005642945.novalocal sudo[102947]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102947]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102950]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./cim-resource-allocation-setting-data.json Mar 09 20:35:30 np0005642945.novalocal sudo[102950]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102950]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102953]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./cim-storage-allocation-setting-data.json Mar 09 20:35:30 np0005642945.novalocal sudo[102953]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102953]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102956]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./cim-virtual-system-setting-data.json Mar 09 20:35:30 np0005642945.novalocal sudo[102956]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102956]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102959]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-aggr-disk-filter.json Mar 09 20:35:30 np0005642945.novalocal sudo[102959]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102959]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102962]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-aggr-iops-filter.json Mar 09 20:35:30 np0005642945.novalocal sudo[102962]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102962]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102965]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-aggr-num-instances.json Mar 09 20:35:30 np0005642945.novalocal sudo[102965]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102965]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102968]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-cpu-mode.json Mar 09 20:35:30 np0005642945.novalocal sudo[102968]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102968]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102971]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-cpu-pinning.json Mar 09 20:35:30 np0005642945.novalocal sudo[102971]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102971]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102974]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-guest-memory-backing.json Mar 09 20:35:30 np0005642945.novalocal sudo[102974]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102974]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102977]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-guest-shutdown.json Mar 09 20:35:30 np0005642945.novalocal sudo[102977]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102977]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102980]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-host-capabilities.json Mar 09 20:35:30 np0005642945.novalocal sudo[102980]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102980]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102983]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-hypervisor.json Mar 09 20:35:30 np0005642945.novalocal sudo[102983]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102983]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102986]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-instance-data.json Mar 09 20:35:30 np0005642945.novalocal sudo[102986]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102986]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102989]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-libvirt-image.json Mar 09 20:35:30 np0005642945.novalocal sudo[102989]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102989]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102992]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-libvirt.json Mar 09 20:35:30 np0005642945.novalocal sudo[102992]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102992]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102995]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-quota.json Mar 09 20:35:30 np0005642945.novalocal sudo[102995]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102995]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[102998]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-randomgen.json Mar 09 20:35:30 np0005642945.novalocal sudo[102998]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[102998]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103001]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-vcputopology.json Mar 09 20:35:30 np0005642945.novalocal sudo[103001]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103001]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103004]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-vmware-flavor.json Mar 09 20:35:30 np0005642945.novalocal sudo[103004]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103004]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103007]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-vmware-quota-flavor.json Mar 09 20:35:30 np0005642945.novalocal sudo[103007]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103007]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103010]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-vmware.json Mar 09 20:35:30 np0005642945.novalocal sudo[103010]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103010]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103013]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-vtpm-hw.json Mar 09 20:35:30 np0005642945.novalocal sudo[103013]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103013]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103016]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-vtpm.json Mar 09 20:35:30 np0005642945.novalocal sudo[103016]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103016]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103019]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-watchdog.json Mar 09 20:35:30 np0005642945.novalocal sudo[103019]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103019]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103022]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./compute-xenapi.json Mar 09 20:35:30 np0005642945.novalocal sudo[103022]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103022]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103025]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./glance-common-image-props.json Mar 09 20:35:30 np0005642945.novalocal sudo[103025]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103025]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103028]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./image-signature-verification.json Mar 09 20:35:30 np0005642945.novalocal sudo[103028]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103028]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:30 np0005642945.novalocal sudo[103031]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./operating-system.json Mar 09 20:35:30 np0005642945.novalocal sudo[103031]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:30 np0005642945.novalocal sudo[103031]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103034]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./software-databases.json Mar 09 20:35:31 np0005642945.novalocal sudo[103034]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103034]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103037]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./software-runtimes.json Mar 09 20:35:31 np0005642945.novalocal sudo[103037]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103037]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103040]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./software-webservers.json Mar 09 20:35:31 np0005642945.novalocal sudo[103040]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103040]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103043]: root : PWD=/var/log/weirdo-project/logs/etc/glance/metadefs ; USER=root ; COMMAND=/bin/chmod 644 ./storage-volume-type.json Mar 09 20:35:31 np0005642945.novalocal sudo[103043]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103043]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103046]: root : PWD=/var/log/weirdo-project/logs/etc/heat ; USER=root ; COMMAND=/bin/chmod 644 ./api-paste.ini Mar 09 20:35:31 np0005642945.novalocal sudo[103046]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103046]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103049]: root : PWD=/var/log/weirdo-project/logs/etc/heat ; USER=root ; COMMAND=/bin/chmod 644 ./heat.conf Mar 09 20:35:31 np0005642945.novalocal sudo[103049]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103049]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103052]: root : PWD=/var/log/weirdo-project/logs/etc/heat ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:31 np0005642945.novalocal sudo[103052]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103052]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103055]: root : PWD=/var/log/weirdo-project/logs/etc/heat/environment.d ; USER=root ; COMMAND=/bin/chmod 644 ./default.yaml Mar 09 20:35:31 np0005642945.novalocal sudo[103055]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103055]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103058]: root : PWD=/var/log/weirdo-project/logs/etc/heat/templates ; USER=root ; COMMAND=/bin/chmod 644 ./AWS_CloudWatch_Alarm.yaml Mar 09 20:35:31 np0005642945.novalocal sudo[103058]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103058]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103061]: root : PWD=/var/log/weirdo-project/logs/etc/heat/templates ; USER=root ; COMMAND=/bin/chmod 644 ./AWS_RDS_DBInstance.yaml Mar 09 20:35:31 np0005642945.novalocal sudo[103061]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103061]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103064]: root : PWD=/var/log/weirdo-project/logs/etc/heat/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:31 np0005642945.novalocal sudo[103064]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103064]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103067]: root : PWD=/var/log/weirdo-project/logs/etc/keystone/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:31 np0005642945.novalocal sudo[103067]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103067]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103070]: root : PWD=/var/log/weirdo-project/logs/etc/keystone/fernet-keys ; USER=root ; COMMAND=/bin/chmod 644 ./1 Mar 09 20:35:31 np0005642945.novalocal sudo[103070]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103070]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103073]: root : PWD=/var/log/weirdo-project/logs/etc/keystone/fernet-keys ; USER=root ; COMMAND=/bin/chmod 644 ./2 Mar 09 20:35:31 np0005642945.novalocal sudo[103073]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103073]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103076]: root : PWD=/var/log/weirdo-project/logs/etc/keystone/fernet-keys ; USER=root ; COMMAND=/bin/chmod 644 ./0 Mar 09 20:35:31 np0005642945.novalocal sudo[103076]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103076]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103079]: root : PWD=/var/log/weirdo-project/logs/etc/keystone/credential-keys ; USER=root ; COMMAND=/bin/chmod 644 ./1 Mar 09 20:35:31 np0005642945.novalocal sudo[103079]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103079]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103082]: root : PWD=/var/log/weirdo-project/logs/etc/keystone/credential-keys ; USER=root ; COMMAND=/bin/chmod 644 ./0 Mar 09 20:35:31 np0005642945.novalocal sudo[103082]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103082]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103085]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 644 ./default_catalog.templates Mar 09 20:35:31 np0005642945.novalocal sudo[103085]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103085]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103088]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 644 ./keystone.conf Mar 09 20:35:31 np0005642945.novalocal sudo[103088]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103088]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103091]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 644 ./logging.conf Mar 09 20:35:31 np0005642945.novalocal sudo[103091]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103091]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103094]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 644 ./policy.json Mar 09 20:35:31 np0005642945.novalocal sudo[103094]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103094]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103097]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 644 ./sso_callback_template.html Mar 09 20:35:31 np0005642945.novalocal sudo[103097]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103097]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103100]: root : PWD=/var/log/weirdo-project/logs/etc/keystone ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:31 np0005642945.novalocal sudo[103100]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103100]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103103]: root : PWD=/var/log/weirdo-project/logs/etc/magnum ; USER=root ; COMMAND=/bin/chmod 644 ./api-paste.ini Mar 09 20:35:31 np0005642945.novalocal sudo[103103]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103103]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103106]: root : PWD=/var/log/weirdo-project/logs/etc/magnum ; USER=root ; COMMAND=/bin/chmod 644 ./magnum.conf Mar 09 20:35:31 np0005642945.novalocal sudo[103106]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103106]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103109]: root : PWD=/var/log/weirdo-project/logs/etc/magnum ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:31 np0005642945.novalocal sudo[103109]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103109]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103112]: root : PWD=/var/log/weirdo-project/logs/etc/magnum/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:31 np0005642945.novalocal sudo[103112]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103112]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103115]: root : PWD=/var/log/weirdo-project/logs/etc/mistral/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:31 np0005642945.novalocal sudo[103115]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103115]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103118]: root : PWD=/var/log/weirdo-project/logs/etc/mistral ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:31 np0005642945.novalocal sudo[103118]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103118]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103121]: root : PWD=/var/log/weirdo-project/logs/etc/mistral ; USER=root ; COMMAND=/bin/chmod 644 ./logging.conf Mar 09 20:35:31 np0005642945.novalocal sudo[103121]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103121]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103124]: root : PWD=/var/log/weirdo-project/logs/etc/mistral ; USER=root ; COMMAND=/bin/chmod 644 ./mistral.conf Mar 09 20:35:31 np0005642945.novalocal sudo[103124]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103124]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103127]: root : PWD=/var/log/weirdo-project/logs/etc/mistral ; USER=root ; COMMAND=/bin/chmod 644 ./policy.json Mar 09 20:35:31 np0005642945.novalocal sudo[103127]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103127]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103130]: root : PWD=/var/log/weirdo-project/logs/etc/mistral ; USER=root ; COMMAND=/bin/chmod 644 ./wf_trace_logging.conf Mar 09 20:35:31 np0005642945.novalocal sudo[103130]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103130]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:31 np0005642945.novalocal sudo[103133]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./ovnsb-privkey.pem Mar 09 20:35:31 np0005642945.novalocal sudo[103133]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:31 np0005642945.novalocal sudo[103133]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103136]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./ovn.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103136]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103136]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103139]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./rootwrap.conf Mar 09 20:35:32 np0005642945.novalocal sudo[103139]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103139]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103142]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./README Mar 09 20:35:32 np0005642945.novalocal sudo[103142]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103142]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103145]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./neutron.conf Mar 09 20:35:32 np0005642945.novalocal sudo[103145]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103145]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103148]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./api-paste.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103148]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103148]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103151]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./dhcp_agent.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103151]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103151]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103154]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./l3_agent.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103154]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103154]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103157]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./metadata_agent.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103157]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103157]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103160]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./switchcacert.pem Mar 09 20:35:32 np0005642945.novalocal sudo[103160]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103160]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103163]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./neutron_ovn_metadata_agent.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103163]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103163]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103166]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:32 np0005642945.novalocal sudo[103166]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103166]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103169]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./ovnnb-privkey.pem Mar 09 20:35:32 np0005642945.novalocal sudo[103169]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103169]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103172]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./ovnnb-cert.pem Mar 09 20:35:32 np0005642945.novalocal sudo[103172]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103172]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103175]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./ovnsb-cert.pem Mar 09 20:35:32 np0005642945.novalocal sudo[103175]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103175]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103178]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/plugins/ml2 ; USER=root ; COMMAND=/bin/chmod 644 ./ml2_conf.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103178]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103178]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103181]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/plugins/ml2 ; USER=root ; COMMAND=/bin/chmod 644 ./ovn_agent.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103181]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103181]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103184]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/plugins/ml2 ; USER=root ; COMMAND=/bin/chmod 644 ./sriov_agent.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103184]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103184]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103187]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:32 np0005642945.novalocal sudo[103187]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103187]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103190]: root : PWD=/var/log/weirdo-project/logs/etc/nova ; USER=root ; COMMAND=/bin/chmod 644 ./api-paste.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103190]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103190]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103193]: root : PWD=/var/log/weirdo-project/logs/etc/nova ; USER=root ; COMMAND=/bin/chmod 644 ./nova.conf Mar 09 20:35:32 np0005642945.novalocal sudo[103193]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103193]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103196]: root : PWD=/var/log/weirdo-project/logs/etc/nova ; USER=root ; COMMAND=/bin/chmod 644 ./policy.json Mar 09 20:35:32 np0005642945.novalocal sudo[103196]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103196]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103199]: root : PWD=/var/log/weirdo-project/logs/etc/nova ; USER=root ; COMMAND=/bin/chmod 644 ./release Mar 09 20:35:32 np0005642945.novalocal sudo[103199]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103199]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103202]: root : PWD=/var/log/weirdo-project/logs/etc/nova ; USER=root ; COMMAND=/bin/chmod 644 ./rootwrap.conf Mar 09 20:35:32 np0005642945.novalocal sudo[103202]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103202]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103205]: root : PWD=/var/log/weirdo-project/logs/etc/nova ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:32 np0005642945.novalocal sudo[103205]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103205]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103208]: root : PWD=/var/log/weirdo-project/logs/etc/nova/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:32 np0005642945.novalocal sudo[103208]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103208]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103211]: root : PWD=/var/log/weirdo-project/logs/etc/nova ; USER=root ; COMMAND=/bin/chmod 644 ./nova-compute.conf Mar 09 20:35:32 np0005642945.novalocal sudo[103211]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103211]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103214]: root : PWD=/var/log/weirdo-project/logs/etc/placement ; USER=root ; COMMAND=/bin/chmod 644 ./placement.conf Mar 09 20:35:32 np0005642945.novalocal sudo[103214]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103214]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103217]: root : PWD=/var/log/weirdo-project/logs/etc/placement ; USER=root ; COMMAND=/bin/chmod 644 ./policy.json Mar 09 20:35:32 np0005642945.novalocal sudo[103217]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103217]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103220]: root : PWD=/var/log/weirdo-project/logs/etc/placement ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:32 np0005642945.novalocal sudo[103220]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103220]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103223]: root : PWD=/var/log/weirdo-project/logs/etc/placement/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:32 np0005642945.novalocal sudo[103223]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103223]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103226]: root : PWD=/var/log/weirdo-project/logs/etc/tempest ; USER=root ; COMMAND=/bin/chmod 644 ./accounts.yaml.sample Mar 09 20:35:32 np0005642945.novalocal sudo[103226]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103226]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103229]: root : PWD=/var/log/weirdo-project/logs/etc/tempest ; USER=root ; COMMAND=/bin/chmod 644 ./allow-list.yaml Mar 09 20:35:32 np0005642945.novalocal sudo[103229]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103229]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103232]: root : PWD=/var/log/weirdo-project/logs/etc/tempest ; USER=root ; COMMAND=/bin/chmod 644 ./logging.conf.sample Mar 09 20:35:32 np0005642945.novalocal sudo[103232]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103232]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103235]: root : PWD=/var/log/weirdo-project/logs/etc/tempest ; USER=root ; COMMAND=/bin/chmod 644 ./rbac-persona-accounts.yaml.sample Mar 09 20:35:32 np0005642945.novalocal sudo[103235]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103235]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103238]: root : PWD=/var/log/weirdo-project/logs/etc/tempest ; USER=root ; COMMAND=/bin/chmod 644 ./tempest.conf Mar 09 20:35:32 np0005642945.novalocal sudo[103238]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103238]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103241]: root : PWD=/var/log/weirdo-project/logs/etc/trove ; USER=root ; COMMAND=/bin/chmod 644 ./api-paste.ini Mar 09 20:35:32 np0005642945.novalocal sudo[103241]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:32 np0005642945.novalocal sudo[103241]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:32 np0005642945.novalocal sudo[103244]: root : PWD=/var/log/weirdo-project/logs/etc/trove ; USER=root ; COMMAND=/bin/chmod 644 ./trove.conf Mar 09 20:35:32 np0005642945.novalocal sudo[103244]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103244]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103247]: root : PWD=/var/log/weirdo-project/logs/etc/trove ; USER=root ; COMMAND=/bin/chmod 644 ./trove-conductor.conf Mar 09 20:35:33 np0005642945.novalocal sudo[103247]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103247]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103250]: root : PWD=/var/log/weirdo-project/logs/etc/trove ; USER=root ; COMMAND=/bin/chmod 644 ./trove-taskmanager.conf Mar 09 20:35:33 np0005642945.novalocal sudo[103250]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103250]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103253]: root : PWD=/var/log/weirdo-project/logs/etc/trove ; USER=root ; COMMAND=/bin/chmod 644 ./guest_info Mar 09 20:35:33 np0005642945.novalocal sudo[103253]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103253]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103256]: root : PWD=/var/log/weirdo-project/logs/etc/trove ; USER=root ; COMMAND=/bin/chmod 644 ./trove-guestagent.conf Mar 09 20:35:33 np0005642945.novalocal sudo[103256]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103256]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103259]: root : PWD=/var/log/weirdo-project/logs/etc/trove ; USER=root ; COMMAND=/bin/chmod 644 ./policy.yaml Mar 09 20:35:33 np0005642945.novalocal sudo[103259]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103259]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103262]: root : PWD=/var/log/weirdo-project/logs/etc/trove/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:33 np0005642945.novalocal sudo[103262]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103262]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103265]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifcfg-lo Mar 09 20:35:33 np0005642945.novalocal sudo[103265]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103265]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103268]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifdown Mar 09 20:35:33 np0005642945.novalocal sudo[103268]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103268]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103271]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifdown-eth Mar 09 20:35:33 np0005642945.novalocal sudo[103271]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103271]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103274]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifdown-ipv6 Mar 09 20:35:33 np0005642945.novalocal sudo[103274]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103274]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103277]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifdown-ovs Mar 09 20:35:33 np0005642945.novalocal sudo[103277]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103277]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103280]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifdown-post Mar 09 20:35:33 np0005642945.novalocal sudo[103280]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103280]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103283]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifdown-routes Mar 09 20:35:33 np0005642945.novalocal sudo[103283]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103283]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103286]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifdown-tunnel Mar 09 20:35:33 np0005642945.novalocal sudo[103286]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103286]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103289]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifup Mar 09 20:35:33 np0005642945.novalocal sudo[103289]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103289]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103292]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifup-aliases Mar 09 20:35:33 np0005642945.novalocal sudo[103292]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103292]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103295]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifup-eth Mar 09 20:35:33 np0005642945.novalocal sudo[103295]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103295]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103298]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifup-ipv6 Mar 09 20:35:33 np0005642945.novalocal sudo[103298]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103298]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103301]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifup-ovs Mar 09 20:35:33 np0005642945.novalocal sudo[103301]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103301]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103304]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifup-post Mar 09 20:35:33 np0005642945.novalocal sudo[103304]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103304]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103307]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifup-routes Mar 09 20:35:33 np0005642945.novalocal sudo[103307]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103307]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103310]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifup-tunnel Mar 09 20:35:33 np0005642945.novalocal sudo[103310]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103310]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103313]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./init.ipv6-global Mar 09 20:35:33 np0005642945.novalocal sudo[103313]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103313]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103316]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./network-functions Mar 09 20:35:33 np0005642945.novalocal sudo[103316]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103316]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103319]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./network-functions-ipv6 Mar 09 20:35:33 np0005642945.novalocal sudo[103319]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103319]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103322]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifcfg-loop1 Mar 09 20:35:33 np0005642945.novalocal sudo[103322]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103322]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103325]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifcfg-eth0 Mar 09 20:35:33 np0005642945.novalocal sudo[103325]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103325]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103328]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./readme-ifcfg-rh.txt Mar 09 20:35:33 np0005642945.novalocal sudo[103328]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103328]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103331]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig/network-scripts ; USER=root ; COMMAND=/bin/chmod 644 ./ifcfg-br-ex Mar 09 20:35:33 np0005642945.novalocal sudo[103331]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103331]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103334]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-northd Mar 09 20:35:33 np0005642945.novalocal sudo[103334]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103334]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103337]: root : PWD=/var/log/weirdo-project/logs/etc/sysconfig ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-controller Mar 09 20:35:33 np0005642945.novalocal sudo[103337]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103337]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:33 np0005642945.novalocal sudo[103340]: root : PWD=/var/log/weirdo-project/logs/etc/rabbitmq/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:33 np0005642945.novalocal sudo[103340]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:33 np0005642945.novalocal sudo[103340]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103343]: root : PWD=/var/log/weirdo-project/logs/etc/rabbitmq ; USER=root ; COMMAND=/bin/chmod 644 ./rabbitmq.conf Mar 09 20:35:34 np0005642945.novalocal sudo[103343]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103343]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103346]: root : PWD=/var/log/weirdo-project/logs/etc/rabbitmq ; USER=root ; COMMAND=/bin/chmod 644 ./rabbitmq.config Mar 09 20:35:34 np0005642945.novalocal sudo[103346]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103346]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103349]: root : PWD=/var/log/weirdo-project/logs/etc/rabbitmq ; USER=root ; COMMAND=/bin/chmod 644 ./rabbitmq-env.conf Mar 09 20:35:34 np0005642945.novalocal sudo[103349]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103349]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103352]: root : PWD=/var/log/weirdo-project/logs/etc/rabbitmq ; USER=root ; COMMAND=/bin/chmod 644 ./inetrc Mar 09 20:35:34 np0005642945.novalocal sudo[103352]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103352]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103355]: root : PWD=/var/log/weirdo-project/logs/etc/rabbitmq ; USER=root ; COMMAND=/bin/chmod 644 ./rabbitmqadmin.conf Mar 09 20:35:34 np0005642945.novalocal sudo[103355]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103355]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103358]: root : PWD=/var/log/weirdo-project/logs/etc/rabbitmq ; USER=root ; COMMAND=/bin/chmod 644 ./enabled_plugins Mar 09 20:35:34 np0005642945.novalocal sudo[103358]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103358]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103361]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 644 ./my.cnf Mar 09 20:35:34 np0005642945.novalocal sudo[103361]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103361]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103364]: root : PWD=/var/log/weirdo-project/logs/etc/my.cnf.d ; USER=root ; COMMAND=/bin/chmod 644 ./auth_gssapi.cnf Mar 09 20:35:34 np0005642945.novalocal sudo[103364]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103364]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103367]: root : PWD=/var/log/weirdo-project/logs/etc/my.cnf.d ; USER=root ; COMMAND=/bin/chmod 644 ./enable_encryption.preset Mar 09 20:35:34 np0005642945.novalocal sudo[103367]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103367]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103370]: root : PWD=/var/log/weirdo-project/logs/etc/my.cnf.d ; USER=root ; COMMAND=/bin/chmod 644 ./mariadb-server.cnf Mar 09 20:35:34 np0005642945.novalocal sudo[103370]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103370]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103373]: root : PWD=/var/log/weirdo-project/logs/etc/my.cnf.d ; USER=root ; COMMAND=/bin/chmod 644 ./spider.cnf Mar 09 20:35:34 np0005642945.novalocal sudo[103373]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103373]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103376]: root : PWD=/var/log/weirdo-project/logs/etc/my.cnf.d ; USER=root ; COMMAND=/bin/chmod 644 ./mysql-clients.cnf Mar 09 20:35:34 np0005642945.novalocal sudo[103376]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103376]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103379]: root : PWD=/var/log/weirdo-project/logs/etc/my.cnf.d ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:34 np0005642945.novalocal sudo[103379]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103379]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103382]: root : PWD=/var/log/weirdo-project/logs/etc/my.cnf.d ; USER=root ; COMMAND=/bin/chmod 644 ./server.cnf Mar 09 20:35:34 np0005642945.novalocal sudo[103382]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103382]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103385]: root : PWD=/var/log/weirdo-project/logs/etc/my.cnf.d ; USER=root ; COMMAND=/bin/chmod 644 ./client.cnf Mar 09 20:35:34 np0005642945.novalocal sudo[103385]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103385]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103388]: root : PWD=/var/log/weirdo-project/logs/etc/iscsi ; USER=root ; COMMAND=/bin/chmod 644 ./iscsid.conf Mar 09 20:35:34 np0005642945.novalocal sudo[103388]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103388]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103391]: root : PWD=/var/log/weirdo-project/logs/etc/iscsi ; USER=root ; COMMAND=/bin/chmod 644 ./initiatorname.iscsi Mar 09 20:35:34 np0005642945.novalocal sudo[103391]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103391]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103394]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/qemu/networks ; USER=root ; COMMAND=/bin/chmod 644 ./default.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103394]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103394]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103397]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./allow-arp.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103397]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103397]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103400]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./allow-dhcp.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103400]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103400]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103403]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./allow-dhcpv6-server.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103403]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103403]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103406]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./allow-dhcpv6.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103406]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103406]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103409]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./allow-incoming-ipv4.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103409]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103409]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103412]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./allow-incoming-ipv6.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103412]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103412]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103415]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./allow-ipv6.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103415]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103415]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103418]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./clean-traffic-gateway.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103418]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103418]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103421]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./clean-traffic.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103421]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103421]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103424]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-arp-ip-spoofing.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103424]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103424]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103427]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-arp-mac-spoofing.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103427]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103427]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103430]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-arp-spoofing.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103430]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103430]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103433]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-ip-multicast.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103433]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103433]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103436]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-ip-spoofing.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103436]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103436]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:34 np0005642945.novalocal sudo[103439]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-ipv6-multicast.xml Mar 09 20:35:34 np0005642945.novalocal sudo[103439]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:34 np0005642945.novalocal sudo[103439]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103442]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-ipv6-spoofing.xml Mar 09 20:35:35 np0005642945.novalocal sudo[103442]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103442]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103445]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-mac-broadcast.xml Mar 09 20:35:35 np0005642945.novalocal sudo[103445]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103445]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103448]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-mac-spoofing.xml Mar 09 20:35:35 np0005642945.novalocal sudo[103448]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103448]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103451]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-other-rarp-traffic.xml Mar 09 20:35:35 np0005642945.novalocal sudo[103451]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103451]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103454]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./qemu-announce-self-rarp.xml Mar 09 20:35:35 np0005642945.novalocal sudo[103454]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103454]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103457]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./qemu-announce-self.xml Mar 09 20:35:35 np0005642945.novalocal sudo[103457]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103457]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103460]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./allow-dhcp-server.xml Mar 09 20:35:35 np0005642945.novalocal sudo[103460]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103460]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103463]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./allow-ipv4.xml Mar 09 20:35:35 np0005642945.novalocal sudo[103463]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103463]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103466]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt/nwfilter ; USER=root ; COMMAND=/bin/chmod 644 ./no-other-l2-traffic.xml Mar 09 20:35:35 np0005642945.novalocal sudo[103466]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103466]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103469]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtlogd.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103469]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103469]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103472]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./libvirt-admin.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103472]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103472]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103475]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./libvirt.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103475]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103475]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103478]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtnwfilterd.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103478]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103478]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103481]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtlockd.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103481]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103481]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103484]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtnodedevd.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103484]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103484]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103487]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtsecretd.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103487]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103487]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103490]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./network.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103490]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103490]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103495]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtnetworkd.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103495]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103495]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103498]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtinterfaced.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103498]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103498]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103501]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./qemu-lockd.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103501]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103501]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103504]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./qemu.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103504]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103504]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103507]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtqemud.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103507]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103507]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103510]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtstoraged.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103510]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103510]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103513]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./virtproxyd.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103513]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103513]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103516]: root : PWD=/var/log/weirdo-project/logs/etc/libvirt ; USER=root ; COMMAND=/bin/chmod 644 ./libvirtd.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103516]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103516]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103519]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./default.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103519]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103519]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103522]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./.conf.db.~lock~ Mar 09 20:35:35 np0005642945.novalocal sudo[103522]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103522]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103525]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./conf.db Mar 09 20:35:35 np0005642945.novalocal sudo[103525]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103525]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103528]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./system-id.conf Mar 09 20:35:35 np0005642945.novalocal sudo[103528]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103528]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103531]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovnnb-req.pem Mar 09 20:35:35 np0005642945.novalocal sudo[103531]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103531]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103534]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovnnb-cert.pem Mar 09 20:35:35 np0005642945.novalocal sudo[103534]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103534]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103537]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovnsb-req.pem Mar 09 20:35:35 np0005642945.novalocal sudo[103537]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103537]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103540]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovnsb-cert.pem Mar 09 20:35:35 np0005642945.novalocal sudo[103540]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103540]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103543]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovncontroller-req.pem Mar 09 20:35:35 np0005642945.novalocal sudo[103543]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103543]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:35 np0005642945.novalocal sudo[103546]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovncontroller-cert.pem Mar 09 20:35:35 np0005642945.novalocal sudo[103546]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:35 np0005642945.novalocal sudo[103546]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103549]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovncontroller-privkey.pem Mar 09 20:35:36 np0005642945.novalocal sudo[103549]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103549]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103552]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovnnb-privkey.pem Mar 09 20:35:36 np0005642945.novalocal sudo[103552]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103552]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103555]: root : PWD=/var/log/weirdo-project/logs/etc/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovnsb-privkey.pem Mar 09 20:35:36 np0005642945.novalocal sudo[103555]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103555]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103558]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf ; USER=root ; COMMAND=/bin/chmod 644 ./httpd.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103558]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103558]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103561]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf ; USER=root ; COMMAND=/bin/chmod 644 ./magic Mar 09 20:35:36 np0005642945.novalocal sudo[103561]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103561]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103564]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf ; USER=root ; COMMAND=/bin/chmod 644 ./ports.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103564]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103564]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103567]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-barbican_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103567]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103567]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103570]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-designate_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103570]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103570]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103573]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-heat_api_cfn_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103573]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103573]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103576]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-heat_api_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103576]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103576]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103579]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-keystone_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103579]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103579]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103582]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-mistral_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103582]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103582]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103585]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-nova_api_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103585]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103585]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103588]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-nova_metadata_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103588]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103588]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103591]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-placement_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103591]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103591]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103594]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./10-trove_wsgi.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103594]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103594]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103597]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./15-horizon_ssl_vhost.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103597]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103597]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103600]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./15-horizon_vhost.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103600]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103600]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103603]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.d ; USER=root ; COMMAND=/bin/chmod 644 ./openstack-dashboard.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103603]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103603]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103606]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./access_compat.load Mar 09 20:35:36 np0005642945.novalocal sudo[103606]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103606]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103609]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./actions.load Mar 09 20:35:36 np0005642945.novalocal sudo[103609]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103609]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103612]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./alias.conf Mar 09 20:35:36 np0005642945.novalocal sudo[103612]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103612]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103615]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./alias.load Mar 09 20:35:36 np0005642945.novalocal sudo[103615]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103615]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103618]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./auth_basic.load Mar 09 20:35:36 np0005642945.novalocal sudo[103618]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103618]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103621]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./auth_digest.load Mar 09 20:35:36 np0005642945.novalocal sudo[103621]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103621]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103624]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authn_anon.load Mar 09 20:35:36 np0005642945.novalocal sudo[103624]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103624]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103627]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authn_core.load Mar 09 20:35:36 np0005642945.novalocal sudo[103627]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103627]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103630]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authn_dbm.load Mar 09 20:35:36 np0005642945.novalocal sudo[103630]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103630]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103633]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authn_file.load Mar 09 20:35:36 np0005642945.novalocal sudo[103633]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103633]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103636]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authz_core.load Mar 09 20:35:36 np0005642945.novalocal sudo[103636]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103636]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103639]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authz_dbm.load Mar 09 20:35:36 np0005642945.novalocal sudo[103639]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103639]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103642]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authz_groupfile.load Mar 09 20:35:36 np0005642945.novalocal sudo[103642]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103642]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103645]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authz_host.load Mar 09 20:35:36 np0005642945.novalocal sudo[103645]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103645]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103648]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authz_owner.load Mar 09 20:35:36 np0005642945.novalocal sudo[103648]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:36 np0005642945.novalocal sudo[103648]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:36 np0005642945.novalocal sudo[103651]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./authz_user.load Mar 09 20:35:37 np0005642945.novalocal sudo[103651]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103651]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103654]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./autoindex.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103654]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103654]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103657]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./autoindex.load Mar 09 20:35:37 np0005642945.novalocal sudo[103657]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103657]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103660]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./cache.load Mar 09 20:35:37 np0005642945.novalocal sudo[103660]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103660]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103663]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./cgi.load Mar 09 20:35:37 np0005642945.novalocal sudo[103663]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103663]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103666]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./dav_fs.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103666]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103666]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103669]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./dav_fs.load Mar 09 20:35:37 np0005642945.novalocal sudo[103669]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103669]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103672]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./dav.load Mar 09 20:35:37 np0005642945.novalocal sudo[103672]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103672]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103675]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./deflate.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103675]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103675]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103678]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./deflate.load Mar 09 20:35:37 np0005642945.novalocal sudo[103678]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103678]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103681]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./dir.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103681]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103681]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103684]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./dir.load Mar 09 20:35:37 np0005642945.novalocal sudo[103684]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103684]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103687]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./env.load Mar 09 20:35:37 np0005642945.novalocal sudo[103687]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103687]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103690]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./expires.load Mar 09 20:35:37 np0005642945.novalocal sudo[103690]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103690]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103693]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./ext_filter.load Mar 09 20:35:37 np0005642945.novalocal sudo[103693]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103693]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103696]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./filter.load Mar 09 20:35:37 np0005642945.novalocal sudo[103696]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103696]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103699]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./headers.load Mar 09 20:35:37 np0005642945.novalocal sudo[103699]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103699]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103702]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./include.load Mar 09 20:35:37 np0005642945.novalocal sudo[103702]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103702]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103705]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./log_config.load Mar 09 20:35:37 np0005642945.novalocal sudo[103705]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103705]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103708]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./logio.load Mar 09 20:35:37 np0005642945.novalocal sudo[103708]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103708]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103711]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./mime.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103711]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103711]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103714]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./mime.load Mar 09 20:35:37 np0005642945.novalocal sudo[103714]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103714]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103717]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./mime_magic.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103717]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103717]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103720]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./mime_magic.load Mar 09 20:35:37 np0005642945.novalocal sudo[103720]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103720]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103723]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./negotiation.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103723]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103723]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103726]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./negotiation.load Mar 09 20:35:37 np0005642945.novalocal sudo[103726]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103726]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103729]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./prefork.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103729]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103729]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103732]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./prefork.load Mar 09 20:35:37 np0005642945.novalocal sudo[103732]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103732]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103735]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./rewrite.load Mar 09 20:35:37 np0005642945.novalocal sudo[103735]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103735]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103738]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./setenvif.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103738]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103738]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103741]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./setenvif.load Mar 09 20:35:37 np0005642945.novalocal sudo[103741]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103741]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103744]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./socache_shmcb.load Mar 09 20:35:37 np0005642945.novalocal sudo[103744]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103744]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103747]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./speling.load Mar 09 20:35:37 np0005642945.novalocal sudo[103747]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103747]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103750]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./ssl.conf Mar 09 20:35:37 np0005642945.novalocal sudo[103750]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103750]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:37 np0005642945.novalocal sudo[103753]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./ssl.load Mar 09 20:35:37 np0005642945.novalocal sudo[103753]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:37 np0005642945.novalocal sudo[103753]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103756]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./substitute.load Mar 09 20:35:38 np0005642945.novalocal sudo[103756]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103756]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103759]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./suexec.load Mar 09 20:35:38 np0005642945.novalocal sudo[103759]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103759]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103770]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./systemd.load Mar 09 20:35:38 np0005642945.novalocal sudo[103770]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103770]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103773]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./unixd.load Mar 09 20:35:38 np0005642945.novalocal sudo[103773]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103773]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103804]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./usertrack.load Mar 09 20:35:38 np0005642945.novalocal sudo[103804]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103804]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103807]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./version.load Mar 09 20:35:38 np0005642945.novalocal sudo[103807]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103807]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103810]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./vhost_alias.load Mar 09 20:35:38 np0005642945.novalocal sudo[103810]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103810]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103813]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./wsgi.conf Mar 09 20:35:38 np0005642945.novalocal sudo[103813]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103813]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103816]: root : PWD=/var/log/weirdo-project/logs/etc/httpd/conf.modules.d ; USER=root ; COMMAND=/bin/chmod 644 ./wsgi.load Mar 09 20:35:38 np0005642945.novalocal sudo[103816]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103816]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103819]: root : PWD=/var/log/weirdo-project/logs/etc/redis ; USER=root ; COMMAND=/bin/chmod 644 ./redis.conf Mar 09 20:35:38 np0005642945.novalocal sudo[103819]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103819]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103822]: root : PWD=/var/log/weirdo-project/logs/etc/redis ; USER=root ; COMMAND=/bin/chmod 644 ./sentinel.conf Mar 09 20:35:38 np0005642945.novalocal sudo[103822]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103822]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103825]: root : PWD=/var/log/weirdo-project/logs/etc/redis ; USER=root ; COMMAND=/bin/chmod 644 ./redis.conf.puppet Mar 09 20:35:38 np0005642945.novalocal sudo[103825]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103825]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103828]: root : PWD=/var/log/weirdo-project/logs/etc/redis/ssl/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:38 np0005642945.novalocal sudo[103828]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103828]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103831]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 644 ./cinder_policy.yaml.txt Mar 09 20:35:38 np0005642945.novalocal sudo[103831]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103831]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103834]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt ; USER=root ; COMMAND=/bin/chmod 644 ./README.txt Mar 09 20:35:38 np0005642945.novalocal sudo[103834]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103834]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103837]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt ; USER=root ; COMMAND=/bin/chmod 644 ./cinder.yaml Mar 09 20:35:38 np0005642945.novalocal sudo[103837]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103837]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103840]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt ; USER=root ; COMMAND=/bin/chmod 644 ./glance.yaml Mar 09 20:35:38 np0005642945.novalocal sudo[103840]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103840]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103843]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt ; USER=root ; COMMAND=/bin/chmod 644 ./keystone.yaml Mar 09 20:35:38 np0005642945.novalocal sudo[103843]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103843]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103846]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt ; USER=root ; COMMAND=/bin/chmod 644 ./neutron.yaml Mar 09 20:35:38 np0005642945.novalocal sudo[103846]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103846]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103849]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt ; USER=root ; COMMAND=/bin/chmod 644 ./nova.yaml Mar 09 20:35:38 np0005642945.novalocal sudo[103849]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103849]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103852]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt ; USER=root ; COMMAND=/bin/chmod 644 ./heat.yaml Mar 09 20:35:38 np0005642945.novalocal sudo[103852]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103852]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103855]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 644 ./glance_policy.yaml.txt Mar 09 20:35:38 np0005642945.novalocal sudo[103855]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103855]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103858]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 644 ./heat_policy.yaml.txt Mar 09 20:35:38 np0005642945.novalocal sudo[103858]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103858]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103861]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 644 ./keystone_policy.yaml.txt Mar 09 20:35:38 np0005642945.novalocal sudo[103861]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103861]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103864]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 644 ./local_settings.txt Mar 09 20:35:38 np0005642945.novalocal sudo[103864]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103864]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103867]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt ; USER=root ; COMMAND=/bin/chmod 644 ./_10_set_custom_theme.py.example Mar 09 20:35:38 np0005642945.novalocal sudo[103867]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103867]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103870]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt ; USER=root ; COMMAND=/bin/chmod 644 ./_11_toggle_angular_features.py.example Mar 09 20:35:38 np0005642945.novalocal sudo[103870]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103870]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103873]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt ; USER=root ; COMMAND=/bin/chmod 644 ./_2010_integration_tests_deprecated.py.example Mar 09 20:35:38 np0005642945.novalocal sudo[103873]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103873]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103876]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt ; USER=root ; COMMAND=/bin/chmod 644 ./_20_integration_tests_scaffolds.py.example Mar 09 20:35:38 np0005642945.novalocal sudo[103876]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103876]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103879]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt ; USER=root ; COMMAND=/bin/chmod 644 ./_9030_profiler_settings.py.example Mar 09 20:35:38 np0005642945.novalocal sudo[103879]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103879]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103882]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt ; USER=root ; COMMAND=/bin/chmod 644 ./_1699_orchestration_settings.py Mar 09 20:35:38 np0005642945.novalocal sudo[103882]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103882]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103885]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 644 ./neutron_policy.yaml.txt Mar 09 20:35:38 np0005642945.novalocal sudo[103885]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103885]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103888]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/nova_policy.d.txt ; USER=root ; COMMAND=/bin/chmod 644 ./api-extensions.yaml Mar 09 20:35:38 np0005642945.novalocal sudo[103888]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103888]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103891]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard ; USER=root ; COMMAND=/bin/chmod 644 ./nova_policy.yaml.txt Mar 09 20:35:38 np0005642945.novalocal sudo[103891]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103891]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103894]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/ssl.txt/private ; USER=root ; COMMAND=/bin/chmod 644 ./np0005642945.novalocal.pem Mar 09 20:35:38 np0005642945.novalocal sudo[103894]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103894]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103897]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./centos.repo Mar 09 20:35:38 np0005642945.novalocal sudo[103897]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103897]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103900]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./redhat.repo Mar 09 20:35:38 np0005642945.novalocal sudo[103900]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103900]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103903]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./CentOS-Storage-common.repo Mar 09 20:35:38 np0005642945.novalocal sudo[103903]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103903]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103906]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./CentOS-Ceph-Quincy.repo Mar 09 20:35:38 np0005642945.novalocal sudo[103906]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:38 np0005642945.novalocal sudo[103906]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:38 np0005642945.novalocal sudo[103909]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./CentOS-NFV-OpenvSwitch.repo Mar 09 20:35:39 np0005642945.novalocal sudo[103909]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103909]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103912]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./CentOS-Messaging-rabbitmq.repo Mar 09 20:35:39 np0005642945.novalocal sudo[103912]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103912]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103915]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./CentOS-OpenStack-antelope.repo Mar 09 20:35:39 np0005642945.novalocal sudo[103915]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103915]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103918]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./epel-cisco-openh264.repo.rpmsave Mar 09 20:35:39 np0005642945.novalocal sudo[103918]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103918]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103921]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./epel.repo.rpmsave Mar 09 20:35:39 np0005642945.novalocal sudo[103921]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103921]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103924]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./epel-next.repo.rpmsave Mar 09 20:35:39 np0005642945.novalocal sudo[103924]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103924]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103927]: root : PWD=/var/log/weirdo-project/logs/etc/yum.repos.d ; USER=root ; COMMAND=/bin/chmod 644 ./centos-addons.repo Mar 09 20:35:39 np0005642945.novalocal sudo[103927]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103927]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103930]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 644 ./passwd Mar 09 20:35:39 np0005642945.novalocal sudo[103930]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103930]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103933]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 644 ./group Mar 09 20:35:39 np0005642945.novalocal sudo[103933]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103933]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103936]: root : PWD=/var/log/weirdo-project/logs/etc/openstack/puppet ; USER=root ; COMMAND=/bin/chmod 644 ./admin-clouds.yaml Mar 09 20:35:39 np0005642945.novalocal sudo[103936]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103936]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103939]: root : PWD=/var/log/weirdo-project/logs/etc ; USER=root ; COMMAND=/bin/chmod 644 ./fstab Mar 09 20:35:39 np0005642945.novalocal sudo[103939]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103939]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103942]: root : PWD=/var/log/weirdo-project/logs/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./barbican-manage.log Mar 09 20:35:39 np0005642945.novalocal sudo[103942]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103942]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103945]: root : PWD=/var/log/weirdo-project/logs/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./barbican-keystone-listener.log Mar 09 20:35:39 np0005642945.novalocal sudo[103945]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103945]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103948]: root : PWD=/var/log/weirdo-project/logs/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./barbican-worker.log Mar 09 20:35:39 np0005642945.novalocal sudo[103948]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103948]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103951]: root : PWD=/var/log/weirdo-project/logs/barbican ; USER=root ; COMMAND=/bin/chmod 644 ./barbican-retry.log Mar 09 20:35:39 np0005642945.novalocal sudo[103951]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103951]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103954]: root : PWD=/var/log/weirdo-project/logs/designate ; USER=root ; COMMAND=/bin/chmod 644 ./designate-manage.log Mar 09 20:35:39 np0005642945.novalocal sudo[103954]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103954]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103957]: root : PWD=/var/log/weirdo-project/logs/designate ; USER=root ; COMMAND=/bin/chmod 644 ./mdns.log Mar 09 20:35:39 np0005642945.novalocal sudo[103957]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103957]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103960]: root : PWD=/var/log/weirdo-project/logs/designate ; USER=root ; COMMAND=/bin/chmod 644 ./central.log Mar 09 20:35:39 np0005642945.novalocal sudo[103960]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103960]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103963]: root : PWD=/var/log/weirdo-project/logs/designate ; USER=root ; COMMAND=/bin/chmod 644 ./producer.log Mar 09 20:35:39 np0005642945.novalocal sudo[103963]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103963]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103966]: root : PWD=/var/log/weirdo-project/logs/designate ; USER=root ; COMMAND=/bin/chmod 644 ./worker.log Mar 09 20:35:39 np0005642945.novalocal sudo[103966]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103966]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103969]: root : PWD=/var/log/weirdo-project/logs/glance ; USER=root ; COMMAND=/bin/chmod 644 ./api.log Mar 09 20:35:39 np0005642945.novalocal sudo[103969]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103969]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103972]: root : PWD=/var/log/weirdo-project/logs/heat ; USER=root ; COMMAND=/bin/chmod 644 ./heat-engine.log Mar 09 20:35:39 np0005642945.novalocal sudo[103972]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103972]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103975]: root : PWD=/var/log/weirdo-project/logs/horizon ; USER=root ; COMMAND=/bin/chmod 644 ./horizon.log Mar 09 20:35:39 np0005642945.novalocal sudo[103975]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103975]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103978]: root : PWD=/var/log/weirdo-project/logs/keystone ; USER=root ; COMMAND=/bin/chmod 644 ./keystone.log Mar 09 20:35:39 np0005642945.novalocal sudo[103978]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103978]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103981]: root : PWD=/var/log/weirdo-project/logs/keystone ; USER=root ; COMMAND=/bin/chmod 644 ./keystone-manage.log Mar 09 20:35:39 np0005642945.novalocal sudo[103981]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103981]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103984]: root : PWD=/var/log/weirdo-project/logs/magnum ; USER=root ; COMMAND=/bin/chmod 644 ./magnum-api.log Mar 09 20:35:39 np0005642945.novalocal sudo[103984]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103984]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103987]: root : PWD=/var/log/weirdo-project/logs/magnum ; USER=root ; COMMAND=/bin/chmod 644 ./magnum-conductor.log Mar 09 20:35:39 np0005642945.novalocal sudo[103987]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103987]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103990]: root : PWD=/var/log/weirdo-project/logs/mistral ; USER=root ; COMMAND=/bin/chmod 644 ./mistral-db-manage.log Mar 09 20:35:39 np0005642945.novalocal sudo[103990]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103990]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103993]: root : PWD=/var/log/weirdo-project/logs/mistral ; USER=root ; COMMAND=/bin/chmod 644 ./engine.log Mar 09 20:35:39 np0005642945.novalocal sudo[103993]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103993]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103996]: root : PWD=/var/log/weirdo-project/logs/mistral ; USER=root ; COMMAND=/bin/chmod 644 ./executor.log Mar 09 20:35:39 np0005642945.novalocal sudo[103996]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103996]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[103999]: root : PWD=/var/log/weirdo-project/logs/mistral ; USER=root ; COMMAND=/bin/chmod 644 ./event-engine.log Mar 09 20:35:39 np0005642945.novalocal sudo[103999]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[103999]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[104002]: root : PWD=/var/log/weirdo-project/logs/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./server.log Mar 09 20:35:39 np0005642945.novalocal sudo[104002]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[104002]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[104005]: root : PWD=/var/log/weirdo-project/logs/neutron ; USER=root ; COMMAND=/bin/chmod 644 ./neutron-ovn-metadata-agent.log Mar 09 20:35:39 np0005642945.novalocal sudo[104005]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[104005]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[104008]: root : PWD=/var/log/weirdo-project/logs/nova ; USER=root ; COMMAND=/bin/chmod 644 ./nova-manage.log Mar 09 20:35:39 np0005642945.novalocal sudo[104008]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[104008]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[104011]: root : PWD=/var/log/weirdo-project/logs/nova ; USER=root ; COMMAND=/bin/chmod 644 ./nova-novncproxy.log Mar 09 20:35:39 np0005642945.novalocal sudo[104011]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[104011]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[104014]: root : PWD=/var/log/weirdo-project/logs/nova ; USER=root ; COMMAND=/bin/chmod 644 ./nova-conductor.log Mar 09 20:35:39 np0005642945.novalocal sudo[104014]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[104014]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[104017]: root : PWD=/var/log/weirdo-project/logs/nova ; USER=root ; COMMAND=/bin/chmod 644 ./nova-compute.log Mar 09 20:35:39 np0005642945.novalocal sudo[104017]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[104017]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:39 np0005642945.novalocal sudo[104020]: root : PWD=/var/log/weirdo-project/logs/nova ; USER=root ; COMMAND=/bin/chmod 644 ./nova-scheduler.log Mar 09 20:35:39 np0005642945.novalocal sudo[104020]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:39 np0005642945.novalocal sudo[104020]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104023]: root : PWD=/var/log/weirdo-project/logs/nova ; USER=root ; COMMAND=/bin/chmod 644 ./nova-api.log Mar 09 20:35:40 np0005642945.novalocal sudo[104023]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104023]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104026]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovsdb-server-nb.log Mar 09 20:35:40 np0005642945.novalocal sudo[104026]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104026]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104029]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovsdb-server-sb.log Mar 09 20:35:40 np0005642945.novalocal sudo[104029]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104029]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104032]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-northd.log Mar 09 20:35:40 np0005642945.novalocal sudo[104032]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104032]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104035]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-controller.log Mar 09 20:35:40 np0005642945.novalocal sudo[104035]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104035]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104038]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-nbctl_show.txt Mar 09 20:35:40 np0005642945.novalocal sudo[104038]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104038]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104041]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-nbctl_get-connection.txt Mar 09 20:35:40 np0005642945.novalocal sudo[104041]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104041]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104044]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-nbctl_get-ssl.txt Mar 09 20:35:40 np0005642945.novalocal sudo[104044]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104044]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104047]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-sbctl_show.txt Mar 09 20:35:40 np0005642945.novalocal sudo[104047]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104047]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104050]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-sbctl_get-connection.txt Mar 09 20:35:40 np0005642945.novalocal sudo[104050]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104050]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104053]: root : PWD=/var/log/weirdo-project/logs/ovn ; USER=root ; COMMAND=/bin/chmod 644 ./ovn-sbctl_get-ssl.txt Mar 09 20:35:40 np0005642945.novalocal sudo[104053]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104053]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104056]: root : PWD=/var/log/weirdo-project/logs/placement ; USER=root ; COMMAND=/bin/chmod 644 ./placement.log Mar 09 20:35:40 np0005642945.novalocal sudo[104056]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104056]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104059]: root : PWD=/var/log/weirdo-project/logs/trove ; USER=root ; COMMAND=/bin/chmod 644 ./trove-conductor.log Mar 09 20:35:40 np0005642945.novalocal sudo[104059]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104059]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104062]: root : PWD=/var/log/weirdo-project/logs/trove ; USER=root ; COMMAND=/bin/chmod 644 ./trove-manage.log Mar 09 20:35:40 np0005642945.novalocal sudo[104062]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104062]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104065]: root : PWD=/var/log/weirdo-project/logs/trove ; USER=root ; COMMAND=/bin/chmod 644 ./trove-taskmanager.log Mar 09 20:35:40 np0005642945.novalocal sudo[104065]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104065]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104068]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./puppet.conf Mar 09 20:35:40 np0005642945.novalocal sudo[104068]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104068]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104071]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./syslog.txt Mar 09 20:35:40 np0005642945.novalocal sudo[104071]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104071]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104074]: root : PWD=/var/log/weirdo-project/logs/rabbitmq ; USER=root ; COMMAND=/bin/chmod 644 ./rabbit@localhost6.log Mar 09 20:35:40 np0005642945.novalocal sudo[104074]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104074]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104077]: root : PWD=/var/log/weirdo-project/logs/rabbitmq ; USER=root ; COMMAND=/bin/chmod 644 ./rabbit@localhost6_upgrade.log Mar 09 20:35:40 np0005642945.novalocal sudo[104077]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104077]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104080]: root : PWD=/var/log/weirdo-project/logs/mariadb ; USER=root ; COMMAND=/bin/chmod 644 ./mariadb.log Mar 09 20:35:40 np0005642945.novalocal sudo[104080]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104080]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104083]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./dstat.log Mar 09 20:35:40 np0005642945.novalocal sudo[104083]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104083]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104086]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./iostat.log Mar 09 20:35:40 np0005642945.novalocal sudo[104086]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104086]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104089]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./iotop.log Mar 09 20:35:40 np0005642945.novalocal sudo[104089]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104089]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104092]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./virsh-net-list.txt Mar 09 20:35:40 np0005642945.novalocal sudo[104092]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104092]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104095]: root : PWD=/var/log/weirdo-project/logs/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovs-pki.log Mar 09 20:35:40 np0005642945.novalocal sudo[104095]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104095]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104098]: root : PWD=/var/log/weirdo-project/logs/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovsdb-server.log Mar 09 20:35:40 np0005642945.novalocal sudo[104098]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104098]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104101]: root : PWD=/var/log/weirdo-project/logs/openvswitch ; USER=root ; COMMAND=/bin/chmod 644 ./ovs-vswitchd.log Mar 09 20:35:40 np0005642945.novalocal sudo[104101]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104101]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104104]: root : PWD=/var/log/weirdo-project/logs/sudoers.d ; USER=root ; COMMAND=/bin/chmod 644 ./90-cloud-init-users Mar 09 20:35:40 np0005642945.novalocal sudo[104104]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104104]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104107]: root : PWD=/var/log/weirdo-project/logs/sudoers.d ; USER=root ; COMMAND=/bin/chmod 644 ./neutron Mar 09 20:35:40 np0005642945.novalocal sudo[104107]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104107]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104110]: root : PWD=/var/log/weirdo-project/logs/sudoers.d ; USER=root ; COMMAND=/bin/chmod 644 ./nova Mar 09 20:35:40 np0005642945.novalocal sudo[104110]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104110]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104113]: root : PWD=/var/log/weirdo-project/logs/sudoers.d ; USER=root ; COMMAND=/bin/chmod 644 ./designate Mar 09 20:35:40 np0005642945.novalocal sudo[104113]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104113]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104116]: root : PWD=/var/log/weirdo-project/logs/sudoers.d ; USER=root ; COMMAND=/bin/chmod 644 ./zuul Mar 09 20:35:40 np0005642945.novalocal sudo[104116]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104116]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:40 np0005642945.novalocal sudo[104119]: root : PWD=/var/log/weirdo-project/logs/sudoers.d ; USER=root ; COMMAND=/bin/chmod 644 ./glance Mar 09 20:35:40 np0005642945.novalocal sudo[104119]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:40 np0005642945.novalocal sudo[104119]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104122]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./sudoers.txt Mar 09 20:35:41 np0005642945.novalocal sudo[104122]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104122]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104125]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./error_log Mar 09 20:35:41 np0005642945.novalocal sudo[104125]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104125]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104128]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./horizon_error.log Mar 09 20:35:41 np0005642945.novalocal sudo[104128]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104128]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104131]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./horizon_ssl_error.log Mar 09 20:35:41 np0005642945.novalocal sudo[104131]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104131]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104134]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./trove_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104134]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104134]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104137]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./placement_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104137]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104137]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104140]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./nova_metadata_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104140]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104140]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104143]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./nova_api_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104143]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104143]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104146]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./mistral_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104146]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104146]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104149]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./keystone_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104149]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104149]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104152]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./heat_api_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104152]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104152]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104155]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./heat_api_cfn_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104155]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104155]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104158]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./designate_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104158]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104158]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104161]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./barbican_wsgi_error_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104161]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104161]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104164]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./horizon_access.log Mar 09 20:35:41 np0005642945.novalocal sudo[104164]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104164]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104167]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./horizon_ssl_access.log Mar 09 20:35:41 np0005642945.novalocal sudo[104167]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104167]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104170]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./trove_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104170]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104170]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104173]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./placement_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104173]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104173]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104176]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./nova_metadata_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104176]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104176]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104179]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./nova_api_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104179]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104179]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104182]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./mistral_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104182]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104182]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104185]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./keystone_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104185]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104185]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104188]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./heat_api_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104188]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104188]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104191]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./heat_api_cfn_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104191]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104191]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104194]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./designate_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104194]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104194]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104197]: root : PWD=/var/log/weirdo-project/logs/apache ; USER=root ; COMMAND=/bin/chmod 644 ./barbican_wsgi_access_ssl.log Mar 09 20:35:41 np0005642945.novalocal sudo[104197]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104197]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104200]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./redis.log.txt Mar 09 20:35:41 np0005642945.novalocal sudo[104200]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104200]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104203]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./audit.log.txt Mar 09 20:35:41 np0005642945.novalocal sudo[104203]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104203]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104206]: root : PWD=/var/log/weirdo-project/logs/cron ; USER=root ; COMMAND=/bin/chmod 644 ./heat Mar 09 20:35:41 np0005642945.novalocal sudo[104206]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104206]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104209]: root : PWD=/var/log/weirdo-project/logs/cron ; USER=root ; COMMAND=/bin/chmod 644 ./glance Mar 09 20:35:41 np0005642945.novalocal sudo[104209]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104209]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104212]: root : PWD=/var/log/weirdo-project/logs/cron ; USER=root ; COMMAND=/bin/chmod 644 ./nova Mar 09 20:35:41 np0005642945.novalocal sudo[104212]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104212]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104215]: root : PWD=/var/log/weirdo-project/logs/cron ; USER=root ; COMMAND=/bin/chmod 644 ./keystone Mar 09 20:35:41 np0005642945.novalocal sudo[104215]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104215]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104218]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./tempest.conf.txt Mar 09 20:35:41 np0005642945.novalocal sudo[104218]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104218]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104221]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./rpm-qa.txt Mar 09 20:35:41 np0005642945.novalocal sudo[104221]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104221]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104224]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./repolist.txt Mar 09 20:35:41 np0005642945.novalocal sudo[104224]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104224]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104227]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./installed-packages.txt Mar 09 20:35:41 np0005642945.novalocal sudo[104227]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104227]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104230]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./modulelist.txt Mar 09 20:35:41 np0005642945.novalocal sudo[104230]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104230]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104233]: root : PWD=/var/log/weirdo-project/logs/dnf ; USER=root ; COMMAND=/bin/chmod 644 ./dnf.log Mar 09 20:35:41 np0005642945.novalocal sudo[104233]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:41 np0005642945.novalocal sudo[104233]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:41 np0005642945.novalocal sudo[104236]: root : PWD=/var/log/weirdo-project/logs/dnf ; USER=root ; COMMAND=/bin/chmod 644 ./dnf.rpm.log Mar 09 20:35:42 np0005642945.novalocal sudo[104236]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104236]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104239]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./gem-list.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104239]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104239]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104242]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./openrc.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104242]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104242]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104245]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./df.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104245]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104245]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104248]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./free.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104248]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104248]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104251]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./lsmod.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104251]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104251]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104254]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./cpuinfo.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104254]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104254]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104257]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./ps.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104257]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104257]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104260]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./ip_-d_address.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104260]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104260]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104263]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./brctl_show.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104263]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104263]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104266]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./ovs-vsctl_show.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104266]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104266]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104269]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./ovs-vsctl_list_open_vswitch.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104269]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104269]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104272]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./netstat.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104272]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104272]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104275]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./systemctl.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104275]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104275]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104278]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./iptables.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104278]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104278]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104281]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./mount.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104281]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104281]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104284]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./losetup_-al.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104284]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104284]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104287]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./lvm.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104287]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104287]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104290]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./keystone.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104290]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104290]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104293]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./nova.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104293]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104293]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104296]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./placement.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104296]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104296]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104299]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./glance.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104299]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104299]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104302]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./neutron.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104302]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104302]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104305]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./designate.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104305]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104305]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104308]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./heat.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104308]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104308]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104311]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./magnum.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104311]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104311]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104314]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./mistral.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104314]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104314]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104317]: root : PWD=/var/log/weirdo-project/logs/openstack_resources ; USER=root ; COMMAND=/bin/chmod 644 ./trove.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104317]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104317]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104320]: root : PWD=/var/log/weirdo-project/logs ; USER=root ; COMMAND=/bin/chmod 644 ./nova-cell_v2.txt Mar 09 20:35:42 np0005642945.novalocal sudo[104320]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104320]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[102866]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104325]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/chown -R 0:0 /var/log/weirdo-project/logs Mar 09 20:35:42 np0005642945.novalocal sudo[104325]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104325]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104328]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/find /var/log/weirdo-project/logs -type l -execdir sudo rm -f {} ; Mar 09 20:35:42 np0005642945.novalocal sudo[104328]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104331]: root : PWD=/var/log/weirdo-project/logs/etc/glance/rootwrap.d ; USER=root ; COMMAND=/bin/rm -f ./glance_cinder_store.filters Mar 09 20:35:42 np0005642945.novalocal sudo[104331]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104331]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104334]: root : PWD=/var/log/weirdo-project/logs/etc/glance/rootwrap.d ; USER=root ; COMMAND=/bin/rm -f ./os-brick.filters Mar 09 20:35:42 np0005642945.novalocal sudo[104334]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104334]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:42 np0005642945.novalocal sudo[104337]: root : PWD=/var/log/weirdo-project/logs/etc/neutron ; USER=root ; COMMAND=/bin/rm -f ./plugin.ini Mar 09 20:35:42 np0005642945.novalocal sudo[104337]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:42 np0005642945.novalocal sudo[104337]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104340]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/plugins/networking-ovn ; USER=root ; COMMAND=/bin/rm -f ./networking-ovn-metadata-agent.ini Mar 09 20:35:43 np0005642945.novalocal sudo[104340]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104340]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104343]: root : PWD=/var/log/weirdo-project/logs/etc/neutron/plugins/networking-ovn ; USER=root ; COMMAND=/bin/rm -f ./networking-ovn.ini Mar 09 20:35:43 np0005642945.novalocal sudo[104343]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104343]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104346]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/enabled.txt ; USER=root ; COMMAND=/bin/rm -f ./_1610_project_orchestration_panel.py Mar 09 20:35:43 np0005642945.novalocal sudo[104346]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104346]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104349]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/enabled.txt ; USER=root ; COMMAND=/bin/rm -f ./_1620_project_stacks_panel.py Mar 09 20:35:43 np0005642945.novalocal sudo[104349]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104349]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104352]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/enabled.txt ; USER=root ; COMMAND=/bin/rm -f ./_1630_project_resource_types_panel.py Mar 09 20:35:43 np0005642945.novalocal sudo[104352]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104352]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104355]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/enabled.txt ; USER=root ; COMMAND=/bin/rm -f ./_1640_project_template_versions_panel.py Mar 09 20:35:43 np0005642945.novalocal sudo[104355]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104355]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104358]: root : PWD=/var/log/weirdo-project/logs/etc/openstack-dashboard/enabled.txt ; USER=root ; COMMAND=/bin/rm -f ./_1650_project_template_generator_panel.py Mar 09 20:35:43 np0005642945.novalocal sudo[104358]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104358]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104328]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104362]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/puppet-20260309_202910.log /var/log/weirdo-project/logs/puppet-20260309_202910.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104362]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104362]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104365]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/puppet.log /var/log/weirdo-project/logs/puppet.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104365]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104365]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104368]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/barbican/barbican-manage.log /var/log/weirdo-project/logs/barbican/barbican-manage.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104368]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104368]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104371]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/barbican/barbican-keystone-listener.log /var/log/weirdo-project/logs/barbican/barbican-keystone-listener.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104371]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104371]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104374]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/barbican/barbican-worker.log /var/log/weirdo-project/logs/barbican/barbican-worker.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104374]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104374]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104377]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/barbican/barbican-retry.log /var/log/weirdo-project/logs/barbican/barbican-retry.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104377]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104377]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104380]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/designate/designate-manage.log /var/log/weirdo-project/logs/designate/designate-manage.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104380]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104380]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104383]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/designate/mdns.log /var/log/weirdo-project/logs/designate/mdns.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104383]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104383]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104386]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/designate/central.log /var/log/weirdo-project/logs/designate/central.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104386]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104386]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104389]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/designate/producer.log /var/log/weirdo-project/logs/designate/producer.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104389]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104389]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104392]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/designate/worker.log /var/log/weirdo-project/logs/designate/worker.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104392]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104392]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104395]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/glance/api.log /var/log/weirdo-project/logs/glance/api.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104395]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104395]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104398]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/heat/heat-engine.log /var/log/weirdo-project/logs/heat/heat-engine.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104398]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104398]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104401]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/horizon/horizon.log /var/log/weirdo-project/logs/horizon/horizon.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104401]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104401]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104404]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/keystone/keystone.log /var/log/weirdo-project/logs/keystone/keystone.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104404]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104404]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104407]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/keystone/keystone-manage.log /var/log/weirdo-project/logs/keystone/keystone-manage.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104407]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104407]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104410]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/magnum/magnum-api.log /var/log/weirdo-project/logs/magnum/magnum-api.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104410]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104410]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104413]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/magnum/magnum-conductor.log /var/log/weirdo-project/logs/magnum/magnum-conductor.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104413]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104413]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104416]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/mistral/mistral-db-manage.log /var/log/weirdo-project/logs/mistral/mistral-db-manage.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104416]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104416]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104419]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/mistral/engine.log /var/log/weirdo-project/logs/mistral/engine.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104419]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104419]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104422]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/mistral/executor.log /var/log/weirdo-project/logs/mistral/executor.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104422]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104422]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104425]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/mistral/event-engine.log /var/log/weirdo-project/logs/mistral/event-engine.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104425]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104425]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104428]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/neutron/server.log /var/log/weirdo-project/logs/neutron/server.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104428]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104428]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104431]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/neutron/neutron-ovn-metadata-agent.log /var/log/weirdo-project/logs/neutron/neutron-ovn-metadata-agent.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104431]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104431]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104434]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/nova/nova-manage.log /var/log/weirdo-project/logs/nova/nova-manage.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104434]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104434]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104437]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/nova/nova-novncproxy.log /var/log/weirdo-project/logs/nova/nova-novncproxy.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104437]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104437]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104440]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/nova/nova-conductor.log /var/log/weirdo-project/logs/nova/nova-conductor.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104440]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104440]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104443]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/nova/nova-compute.log /var/log/weirdo-project/logs/nova/nova-compute.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104443]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104443]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104446]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/nova/nova-scheduler.log /var/log/weirdo-project/logs/nova/nova-scheduler.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104446]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104446]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104449]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/nova/nova-api.log /var/log/weirdo-project/logs/nova/nova-api.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104449]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104449]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104452]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/ovn/ovsdb-server-nb.log /var/log/weirdo-project/logs/ovn/ovsdb-server-nb.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104452]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104452]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:43 np0005642945.novalocal sudo[104455]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/ovn/ovsdb-server-sb.log /var/log/weirdo-project/logs/ovn/ovsdb-server-sb.txt Mar 09 20:35:43 np0005642945.novalocal sudo[104455]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:43 np0005642945.novalocal sudo[104455]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104458]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/ovn/ovn-northd.log /var/log/weirdo-project/logs/ovn/ovn-northd.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104458]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104458]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104461]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/ovn/ovn-controller.log /var/log/weirdo-project/logs/ovn/ovn-controller.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104461]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104461]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104464]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/placement/placement.log /var/log/weirdo-project/logs/placement/placement.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104464]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104464]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104467]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/trove/trove-conductor.log /var/log/weirdo-project/logs/trove/trove-conductor.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104467]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104467]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104470]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/trove/trove-manage.log /var/log/weirdo-project/logs/trove/trove-manage.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104470]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104470]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104473]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/trove/trove-taskmanager.log /var/log/weirdo-project/logs/trove/trove-taskmanager.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104473]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104473]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104476]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/rabbitmq/rabbit@localhost6.log /var/log/weirdo-project/logs/rabbitmq/rabbit@localhost6.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104476]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104476]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104479]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/rabbitmq/rabbit@localhost6_upgrade.log /var/log/weirdo-project/logs/rabbitmq/rabbit@localhost6_upgrade.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104479]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104479]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104482]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/mariadb/mariadb.log /var/log/weirdo-project/logs/mariadb/mariadb.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104482]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104482]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104485]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/dstat.log /var/log/weirdo-project/logs/dstat.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104485]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104485]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104488]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/iostat.log /var/log/weirdo-project/logs/iostat.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104488]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104488]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104491]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/iotop.log /var/log/weirdo-project/logs/iotop.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104491]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104491]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104494]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/openvswitch/ovs-pki.log /var/log/weirdo-project/logs/openvswitch/ovs-pki.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104494]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104494]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104497]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/openvswitch/ovsdb-server.log /var/log/weirdo-project/logs/openvswitch/ovsdb-server.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104497]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104497]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104500]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/openvswitch/ovs-vswitchd.log /var/log/weirdo-project/logs/openvswitch/ovs-vswitchd.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104500]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104500]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104503]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/horizon_error.log /var/log/weirdo-project/logs/apache/horizon_error.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104503]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104503]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104506]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/horizon_ssl_error.log /var/log/weirdo-project/logs/apache/horizon_ssl_error.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104506]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104506]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104509]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/trove_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/trove_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104509]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104509]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104512]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/placement_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/placement_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104512]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104512]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104515]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/nova_metadata_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/nova_metadata_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104515]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104515]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104518]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/nova_api_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/nova_api_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104518]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104518]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104521]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/mistral_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/mistral_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104521]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104521]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104524]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/keystone_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/keystone_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104524]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104524]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104527]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/heat_api_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/heat_api_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104527]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104527]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104530]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/heat_api_cfn_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/heat_api_cfn_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104530]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104530]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104533]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/designate_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/designate_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104533]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104533]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104536]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/barbican_wsgi_error_ssl.log /var/log/weirdo-project/logs/apache/barbican_wsgi_error_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104536]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104536]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104539]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/horizon_access.log /var/log/weirdo-project/logs/apache/horizon_access.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104539]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104539]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104542]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/horizon_ssl_access.log /var/log/weirdo-project/logs/apache/horizon_ssl_access.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104542]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104542]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104545]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/trove_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/trove_wsgi_access_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104545]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104545]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104548]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/placement_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/placement_wsgi_access_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104548]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104548]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104551]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/nova_metadata_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/nova_metadata_wsgi_access_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104551]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104551]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104554]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/nova_api_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/nova_api_wsgi_access_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104554]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104554]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104557]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/mistral_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/mistral_wsgi_access_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104557]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104557]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104560]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/keystone_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/keystone_wsgi_access_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104560]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104560]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104563]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/heat_api_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/heat_api_wsgi_access_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104563]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:44 np0005642945.novalocal sudo[104563]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:44 np0005642945.novalocal sudo[104566]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/heat_api_cfn_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/heat_api_cfn_wsgi_access_ssl.txt Mar 09 20:35:44 np0005642945.novalocal sudo[104566]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104566]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104569]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/designate_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/designate_wsgi_access_ssl.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104569]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104569]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104572]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/apache/barbican_wsgi_access_ssl.log /var/log/weirdo-project/logs/apache/barbican_wsgi_access_ssl.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104572]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104572]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104575]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/dnf/dnf.log /var/log/weirdo-project/logs/dnf/dnf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104575]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104575]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104578]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/dnf/dnf.rpm.log /var/log/weirdo-project/logs/dnf/dnf.rpm.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104578]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104578]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104582]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/sudoers.d/90-cloud-init-users /var/log/weirdo-project/logs/sudoers.d/90-cloud-init-users.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104582]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104582]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104585]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/sudoers.d/neutron /var/log/weirdo-project/logs/sudoers.d/neutron.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104585]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104585]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104588]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/sudoers.d/nova /var/log/weirdo-project/logs/sudoers.d/nova.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104588]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104588]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104591]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/sudoers.d/designate /var/log/weirdo-project/logs/sudoers.d/designate.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104591]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104591]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104594]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/sudoers.d/zuul /var/log/weirdo-project/logs/sudoers.d/zuul.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104594]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104594]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104597]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/sudoers.d/glance /var/log/weirdo-project/logs/sudoers.d/glance.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104597]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104597]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104600]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/barbican/barbican.conf /var/log/weirdo-project/logs/etc/barbican/barbican.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104600]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104600]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104603]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/barbican/api_audit_map.conf /var/log/weirdo-project/logs/etc/barbican/api_audit_map.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104603]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104603]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104606]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/barbican/barbican-api-paste.ini /var/log/weirdo-project/logs/etc/barbican/barbican-api-paste.ini.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104606]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104606]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104609]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/barbican/barbican-functional.conf /var/log/weirdo-project/logs/etc/barbican/barbican-functional.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104609]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104609]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104612]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/barbican/gunicorn-config.py /var/log/weirdo-project/logs/etc/barbican/gunicorn-config.py.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104612]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104612]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104615]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/barbican/policy.yaml /var/log/weirdo-project/logs/etc/barbican/policy.yaml.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104615]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104615]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104619]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/barbican/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/barbican/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104619]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104619]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104623]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/barbican/vassals/barbican-api.ini /var/log/weirdo-project/logs/etc/barbican/vassals/barbican-api.ini.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104623]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104623]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104626]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/designate/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/designate/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104626]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104626]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104629]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/designate/designate.conf /var/log/weirdo-project/logs/etc/designate/designate.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104629]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104629]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104632]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/designate/rootwrap.conf /var/log/weirdo-project/logs/etc/designate/rootwrap.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104632]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104632]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104635]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/designate/policy.yaml /var/log/weirdo-project/logs/etc/designate/policy.yaml.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104635]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104635]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104638]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/designate/api-paste.ini /var/log/weirdo-project/logs/etc/designate/api-paste.ini.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104638]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104638]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104641]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/designate/pools.yaml /var/log/weirdo-project/logs/etc/designate/pools.yaml.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104641]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104641]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104644]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/glance/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104644]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104644]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104647]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/glance-api-paste.ini /var/log/weirdo-project/logs/etc/glance/glance-api-paste.ini.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104647]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104647]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104650]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/glance-api.conf /var/log/weirdo-project/logs/etc/glance/glance-api.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104650]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104650]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104653]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/glance-cache.conf /var/log/weirdo-project/logs/etc/glance/glance-cache.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104653]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104653]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104656]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/glance-image-import.conf /var/log/weirdo-project/logs/etc/glance/glance-image-import.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104656]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104656]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104659]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/glance-scrubber.conf /var/log/weirdo-project/logs/etc/glance/glance-scrubber.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104659]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104659]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104662]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/glance-swift.conf /var/log/weirdo-project/logs/etc/glance/glance-swift.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104662]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104662]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104665]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/rootwrap.conf /var/log/weirdo-project/logs/etc/glance/rootwrap.conf.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104665]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104665]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:45 np0005642945.novalocal sudo[104668]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/schema-image.json /var/log/weirdo-project/logs/etc/glance/schema-image.json.txt Mar 09 20:35:45 np0005642945.novalocal sudo[104668]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:45 np0005642945.novalocal sudo[104668]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104671]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/policy.yaml /var/log/weirdo-project/logs/etc/glance/policy.yaml.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104671]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104671]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104674]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/cim-processor-allocation-setting-data.json /var/log/weirdo-project/logs/etc/glance/metadefs/cim-processor-allocation-setting-data.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104674]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104674]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104677]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/cim-resource-allocation-setting-data.json /var/log/weirdo-project/logs/etc/glance/metadefs/cim-resource-allocation-setting-data.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104677]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104677]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104680]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/cim-storage-allocation-setting-data.json /var/log/weirdo-project/logs/etc/glance/metadefs/cim-storage-allocation-setting-data.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104680]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104680]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104683]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/cim-virtual-system-setting-data.json /var/log/weirdo-project/logs/etc/glance/metadefs/cim-virtual-system-setting-data.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104683]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104683]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104686]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-aggr-disk-filter.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-aggr-disk-filter.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104686]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104686]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104689]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-aggr-iops-filter.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-aggr-iops-filter.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104689]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104689]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104692]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-aggr-num-instances.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-aggr-num-instances.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104692]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104692]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104695]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-cpu-mode.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-cpu-mode.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104695]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104695]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104698]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-cpu-pinning.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-cpu-pinning.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104698]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104698]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104701]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-guest-memory-backing.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-guest-memory-backing.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104701]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104701]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104704]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-guest-shutdown.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-guest-shutdown.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104704]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104704]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104707]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-host-capabilities.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-host-capabilities.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104707]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104707]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104710]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-hypervisor.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-hypervisor.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104710]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104710]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104713]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-instance-data.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-instance-data.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104713]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104713]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104716]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-libvirt-image.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-libvirt-image.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104716]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104716]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104719]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-libvirt.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-libvirt.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104719]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104719]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104722]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-quota.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-quota.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104722]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104722]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104725]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-randomgen.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-randomgen.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104725]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104725]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104728]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vcputopology.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vcputopology.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104728]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104728]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104731]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vmware-flavor.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vmware-flavor.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104731]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104731]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104734]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vmware-quota-flavor.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vmware-quota-flavor.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104734]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104734]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104737]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vmware.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vmware.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104737]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104737]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104740]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vtpm-hw.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vtpm-hw.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104740]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104740]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104743]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vtpm.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-vtpm.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104743]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104743]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104746]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-watchdog.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-watchdog.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104746]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104746]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104749]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/compute-xenapi.json /var/log/weirdo-project/logs/etc/glance/metadefs/compute-xenapi.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104749]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104749]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104752]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/glance-common-image-props.json /var/log/weirdo-project/logs/etc/glance/metadefs/glance-common-image-props.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104752]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104752]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104755]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/image-signature-verification.json /var/log/weirdo-project/logs/etc/glance/metadefs/image-signature-verification.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104755]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104755]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104758]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/operating-system.json /var/log/weirdo-project/logs/etc/glance/metadefs/operating-system.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104758]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104758]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104761]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/software-databases.json /var/log/weirdo-project/logs/etc/glance/metadefs/software-databases.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104761]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104761]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:46 np0005642945.novalocal sudo[104764]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/software-runtimes.json /var/log/weirdo-project/logs/etc/glance/metadefs/software-runtimes.json.txt Mar 09 20:35:46 np0005642945.novalocal sudo[104764]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:46 np0005642945.novalocal sudo[104764]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104767]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/software-webservers.json /var/log/weirdo-project/logs/etc/glance/metadefs/software-webservers.json.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104767]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104767]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104770]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/glance/metadefs/storage-volume-type.json /var/log/weirdo-project/logs/etc/glance/metadefs/storage-volume-type.json.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104770]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104770]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104773]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/heat/api-paste.ini /var/log/weirdo-project/logs/etc/heat/api-paste.ini.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104773]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104773]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104776]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/heat/heat.conf /var/log/weirdo-project/logs/etc/heat/heat.conf.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104776]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104776]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104779]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/heat/policy.yaml /var/log/weirdo-project/logs/etc/heat/policy.yaml.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104779]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104779]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104782]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/heat/environment.d/default.yaml /var/log/weirdo-project/logs/etc/heat/environment.d/default.yaml.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104782]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104782]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104785]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/heat/templates/AWS_CloudWatch_Alarm.yaml /var/log/weirdo-project/logs/etc/heat/templates/AWS_CloudWatch_Alarm.yaml.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104785]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104785]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104788]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/heat/templates/AWS_RDS_DBInstance.yaml /var/log/weirdo-project/logs/etc/heat/templates/AWS_RDS_DBInstance.yaml.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104788]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104788]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104791]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/heat/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/heat/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104791]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104791]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104794]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/keystone/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104794]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104794]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104797]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/fernet-keys/1 /var/log/weirdo-project/logs/etc/keystone/fernet-keys/1.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104797]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104797]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104800]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/fernet-keys/2 /var/log/weirdo-project/logs/etc/keystone/fernet-keys/2.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104800]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104800]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104803]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/fernet-keys/0 /var/log/weirdo-project/logs/etc/keystone/fernet-keys/0.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104803]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104803]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104806]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/credential-keys/1 /var/log/weirdo-project/logs/etc/keystone/credential-keys/1.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104806]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104806]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104809]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/credential-keys/0 /var/log/weirdo-project/logs/etc/keystone/credential-keys/0.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104809]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104809]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104812]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/default_catalog.templates /var/log/weirdo-project/logs/etc/keystone/default_catalog.templates.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104812]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104812]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104815]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/keystone.conf /var/log/weirdo-project/logs/etc/keystone/keystone.conf.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104815]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104815]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104818]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/logging.conf /var/log/weirdo-project/logs/etc/keystone/logging.conf.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104818]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104818]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104821]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/policy.json /var/log/weirdo-project/logs/etc/keystone/policy.json.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104821]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104821]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104824]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/sso_callback_template.html /var/log/weirdo-project/logs/etc/keystone/sso_callback_template.html.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104824]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104824]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104827]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/keystone/policy.yaml /var/log/weirdo-project/logs/etc/keystone/policy.yaml.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104827]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104827]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104830]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/magnum/api-paste.ini /var/log/weirdo-project/logs/etc/magnum/api-paste.ini.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104830]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104830]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104833]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/magnum/magnum.conf /var/log/weirdo-project/logs/etc/magnum/magnum.conf.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104833]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104833]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104836]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/magnum/policy.yaml /var/log/weirdo-project/logs/etc/magnum/policy.yaml.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104836]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104836]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104839]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/magnum/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/magnum/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104839]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104839]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104842]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/mistral/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/mistral/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104842]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104842]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104845]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/mistral/policy.yaml /var/log/weirdo-project/logs/etc/mistral/policy.yaml.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104845]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104845]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104848]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/mistral/logging.conf /var/log/weirdo-project/logs/etc/mistral/logging.conf.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104848]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104848]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104851]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/mistral/mistral.conf /var/log/weirdo-project/logs/etc/mistral/mistral.conf.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104851]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104851]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104854]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/mistral/policy.json /var/log/weirdo-project/logs/etc/mistral/policy.json.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104854]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104854]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104857]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/mistral/wf_trace_logging.conf /var/log/weirdo-project/logs/etc/mistral/wf_trace_logging.conf.txt Mar 09 20:35:47 np0005642945.novalocal sudo[104857]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:47 np0005642945.novalocal sudo[104857]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:47 np0005642945.novalocal sudo[104860]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/ovnsb-privkey.pem /var/log/weirdo-project/logs/etc/neutron/ovnsb-privkey.pem.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104860]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104860]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104863]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/ovn.ini /var/log/weirdo-project/logs/etc/neutron/ovn.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104863]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104863]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104866]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/rootwrap.conf /var/log/weirdo-project/logs/etc/neutron/rootwrap.conf.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104866]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104866]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104869]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/conf.d/README /var/log/weirdo-project/logs/etc/neutron/conf.d/README.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104869]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104869]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104872]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/neutron.conf /var/log/weirdo-project/logs/etc/neutron/neutron.conf.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104872]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104872]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104875]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/api-paste.ini /var/log/weirdo-project/logs/etc/neutron/api-paste.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104875]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104875]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104878]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/dhcp_agent.ini /var/log/weirdo-project/logs/etc/neutron/dhcp_agent.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104878]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104878]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104881]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/l3_agent.ini /var/log/weirdo-project/logs/etc/neutron/l3_agent.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104881]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104881]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104884]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/metadata_agent.ini /var/log/weirdo-project/logs/etc/neutron/metadata_agent.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104884]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104884]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104887]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/switchcacert.pem /var/log/weirdo-project/logs/etc/neutron/switchcacert.pem.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104887]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104887]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104890]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/neutron_ovn_metadata_agent.ini /var/log/weirdo-project/logs/etc/neutron/neutron_ovn_metadata_agent.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104890]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104890]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104893]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/policy.yaml /var/log/weirdo-project/logs/etc/neutron/policy.yaml.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104893]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104893]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104896]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/ovnnb-privkey.pem /var/log/weirdo-project/logs/etc/neutron/ovnnb-privkey.pem.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104896]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104896]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104899]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/ovnnb-cert.pem /var/log/weirdo-project/logs/etc/neutron/ovnnb-cert.pem.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104899]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104899]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104902]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/ovnsb-cert.pem /var/log/weirdo-project/logs/etc/neutron/ovnsb-cert.pem.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104902]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104902]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104905]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/plugins/ml2/ml2_conf.ini /var/log/weirdo-project/logs/etc/neutron/plugins/ml2/ml2_conf.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104905]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104905]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104908]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/plugins/ml2/ovn_agent.ini /var/log/weirdo-project/logs/etc/neutron/plugins/ml2/ovn_agent.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104908]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104908]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104911]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/plugins/ml2/sriov_agent.ini /var/log/weirdo-project/logs/etc/neutron/plugins/ml2/sriov_agent.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104911]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104911]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104914]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/neutron/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/neutron/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104914]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104914]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104917]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/nova/api-paste.ini /var/log/weirdo-project/logs/etc/nova/api-paste.ini.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104917]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104917]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104920]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/nova/nova.conf /var/log/weirdo-project/logs/etc/nova/nova.conf.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104920]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104920]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104923]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/nova/policy.json /var/log/weirdo-project/logs/etc/nova/policy.json.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104923]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104923]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104926]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/nova/release /var/log/weirdo-project/logs/etc/nova/release.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104926]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104926]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104929]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/nova/rootwrap.conf /var/log/weirdo-project/logs/etc/nova/rootwrap.conf.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104929]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104929]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104932]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/nova/policy.yaml /var/log/weirdo-project/logs/etc/nova/policy.yaml.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104932]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104932]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104935]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/nova/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/nova/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104935]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104935]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104938]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/nova/nova-compute.conf /var/log/weirdo-project/logs/etc/nova/nova-compute.conf.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104938]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104938]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104941]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/placement/placement.conf /var/log/weirdo-project/logs/etc/placement/placement.conf.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104941]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104941]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104944]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/placement/policy.json /var/log/weirdo-project/logs/etc/placement/policy.json.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104944]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104944]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:48 np0005642945.novalocal sudo[104947]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/placement/policy.yaml /var/log/weirdo-project/logs/etc/placement/policy.yaml.txt Mar 09 20:35:48 np0005642945.novalocal sudo[104947]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:48 np0005642945.novalocal sudo[104947]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104950]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/placement/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/placement/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104950]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104950]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104953]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/tempest/accounts.yaml.sample /var/log/weirdo-project/logs/etc/tempest/accounts.yaml.sample.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104953]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104953]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104956]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/tempest/allow-list.yaml /var/log/weirdo-project/logs/etc/tempest/allow-list.yaml.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104956]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104956]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104959]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/tempest/logging.conf.sample /var/log/weirdo-project/logs/etc/tempest/logging.conf.sample.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104959]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104959]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104962]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/tempest/rbac-persona-accounts.yaml.sample /var/log/weirdo-project/logs/etc/tempest/rbac-persona-accounts.yaml.sample.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104962]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104962]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104965]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/tempest/tempest.conf /var/log/weirdo-project/logs/etc/tempest/tempest.conf.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104965]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104965]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104968]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/trove/api-paste.ini /var/log/weirdo-project/logs/etc/trove/api-paste.ini.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104968]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104968]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104971]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/trove/trove.conf /var/log/weirdo-project/logs/etc/trove/trove.conf.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104971]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104971]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104974]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/trove/trove-conductor.conf /var/log/weirdo-project/logs/etc/trove/trove-conductor.conf.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104974]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104974]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104977]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/trove/trove-taskmanager.conf /var/log/weirdo-project/logs/etc/trove/trove-taskmanager.conf.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104977]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104977]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104980]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/trove/guest_info /var/log/weirdo-project/logs/etc/trove/guest_info.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104980]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104980]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104983]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/trove/trove-guestagent.conf /var/log/weirdo-project/logs/etc/trove/trove-guestagent.conf.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104983]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104983]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104986]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/trove/policy.yaml /var/log/weirdo-project/logs/etc/trove/policy.yaml.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104986]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104986]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104989]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/trove/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/trove/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104989]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104989]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104992]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifcfg-lo /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifcfg-lo.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104992]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104992]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104995]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104995]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104995]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[104998]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-eth /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-eth.txt Mar 09 20:35:49 np0005642945.novalocal sudo[104998]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[104998]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105001]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-ipv6 /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-ipv6.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105001]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105001]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105004]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-ovs /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-ovs.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105004]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105004]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105007]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-post /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-post.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105007]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105007]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105010]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-routes /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-routes.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105010]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105010]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105013]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-tunnel /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifdown-tunnel.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105013]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105013]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105016]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105016]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105016]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105019]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-aliases /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-aliases.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105019]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105019]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105022]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-eth /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-eth.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105022]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105022]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105025]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-ipv6 /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-ipv6.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105025]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105025]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105028]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-ovs /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-ovs.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105028]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105028]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105031]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-post /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-post.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105031]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105031]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105034]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-routes /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-routes.txt Mar 09 20:35:49 np0005642945.novalocal sudo[105034]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:49 np0005642945.novalocal sudo[105034]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:49 np0005642945.novalocal sudo[105037]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-tunnel /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifup-tunnel.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105037]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105037]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105040]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/init.ipv6-global /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/init.ipv6-global.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105040]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105040]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105043]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/network-functions /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/network-functions.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105043]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105043]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105046]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/network-functions-ipv6 /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/network-functions-ipv6.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105046]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105046]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105049]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifcfg-loop1 /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifcfg-loop1.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105049]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105049]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105052]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifcfg-eth0 /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifcfg-eth0.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105052]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105052]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105055]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/readme-ifcfg-rh.txt /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/readme-ifcfg-rh.txt.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105055]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105055]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105058]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifcfg-br-ex /var/log/weirdo-project/logs/etc/sysconfig/network-scripts/ifcfg-br-ex.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105058]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105058]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105061]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/ovn-northd /var/log/weirdo-project/logs/etc/sysconfig/ovn-northd.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105061]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105061]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105064]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/sysconfig/ovn-controller /var/log/weirdo-project/logs/etc/sysconfig/ovn-controller.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105064]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105064]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105067]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/rabbitmq/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/rabbitmq/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105067]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105067]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105070]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/rabbitmq/rabbitmq.conf /var/log/weirdo-project/logs/etc/rabbitmq/rabbitmq.conf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105070]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105070]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105073]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/rabbitmq/rabbitmq.config /var/log/weirdo-project/logs/etc/rabbitmq/rabbitmq.config.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105073]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105073]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105076]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/rabbitmq/rabbitmq-env.conf /var/log/weirdo-project/logs/etc/rabbitmq/rabbitmq-env.conf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105076]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105076]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105079]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/rabbitmq/inetrc /var/log/weirdo-project/logs/etc/rabbitmq/inetrc.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105079]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105079]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105082]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/rabbitmq/rabbitmqadmin.conf /var/log/weirdo-project/logs/etc/rabbitmq/rabbitmqadmin.conf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105082]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105082]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105085]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/rabbitmq/enabled_plugins /var/log/weirdo-project/logs/etc/rabbitmq/enabled_plugins.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105085]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105085]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105088]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/my.cnf /var/log/weirdo-project/logs/etc/my.cnf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105088]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105088]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105091]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/my.cnf.d/auth_gssapi.cnf /var/log/weirdo-project/logs/etc/my.cnf.d/auth_gssapi.cnf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105091]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105091]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105094]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/my.cnf.d/enable_encryption.preset /var/log/weirdo-project/logs/etc/my.cnf.d/enable_encryption.preset.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105094]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105094]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105097]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/my.cnf.d/mariadb-server.cnf /var/log/weirdo-project/logs/etc/my.cnf.d/mariadb-server.cnf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105097]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105097]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105100]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/my.cnf.d/spider.cnf /var/log/weirdo-project/logs/etc/my.cnf.d/spider.cnf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105100]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105100]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105103]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/my.cnf.d/mysql-clients.cnf /var/log/weirdo-project/logs/etc/my.cnf.d/mysql-clients.cnf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105103]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105103]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105106]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/my.cnf.d/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/my.cnf.d/np0005642945.novalocal.pem.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105106]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105106]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105109]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/my.cnf.d/server.cnf /var/log/weirdo-project/logs/etc/my.cnf.d/server.cnf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105109]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105109]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105112]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/my.cnf.d/client.cnf /var/log/weirdo-project/logs/etc/my.cnf.d/client.cnf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105112]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105112]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105115]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/iscsi/iscsid.conf /var/log/weirdo-project/logs/etc/iscsi/iscsid.conf.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105115]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105115]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105118]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/iscsi/initiatorname.iscsi /var/log/weirdo-project/logs/etc/iscsi/initiatorname.iscsi.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105118]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105118]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105121]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/qemu/networks/default.xml /var/log/weirdo-project/logs/etc/libvirt/qemu/networks/default.xml.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105121]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105121]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105124]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-arp.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-arp.xml.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105124]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105124]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105127]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-dhcp.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-dhcp.xml.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105127]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105127]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105130]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-dhcpv6-server.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-dhcpv6-server.xml.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105130]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105130]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:50 np0005642945.novalocal sudo[105133]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-dhcpv6.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-dhcpv6.xml.txt Mar 09 20:35:50 np0005642945.novalocal sudo[105133]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:50 np0005642945.novalocal sudo[105133]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105136]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-incoming-ipv4.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-incoming-ipv4.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105136]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105136]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105139]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-incoming-ipv6.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-incoming-ipv6.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105139]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105139]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105142]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-ipv6.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-ipv6.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105142]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105142]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105145]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/clean-traffic-gateway.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/clean-traffic-gateway.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105145]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105145]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105148]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/clean-traffic.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/clean-traffic.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105148]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105148]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105151]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-arp-ip-spoofing.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-arp-ip-spoofing.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105151]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105151]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105154]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-arp-mac-spoofing.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-arp-mac-spoofing.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105154]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105154]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105157]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-arp-spoofing.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-arp-spoofing.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105157]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105157]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105160]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-ip-multicast.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-ip-multicast.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105160]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105160]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105163]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-ip-spoofing.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-ip-spoofing.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105163]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105163]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105166]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-ipv6-multicast.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-ipv6-multicast.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105166]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105166]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105169]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-ipv6-spoofing.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-ipv6-spoofing.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105169]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105169]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105172]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-mac-broadcast.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-mac-broadcast.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105172]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105172]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105175]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-mac-spoofing.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-mac-spoofing.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105175]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105175]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105178]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-other-rarp-traffic.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-other-rarp-traffic.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105178]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105178]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105181]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/qemu-announce-self-rarp.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/qemu-announce-self-rarp.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105181]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105181]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105184]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/qemu-announce-self.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/qemu-announce-self.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105184]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105184]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105187]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-dhcp-server.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-dhcp-server.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105187]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105187]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105190]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-ipv4.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/allow-ipv4.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105190]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105190]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105193]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-other-l2-traffic.xml /var/log/weirdo-project/logs/etc/libvirt/nwfilter/no-other-l2-traffic.xml.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105193]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105193]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105196]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtlogd.conf /var/log/weirdo-project/logs/etc/libvirt/virtlogd.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105196]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105196]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105199]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/libvirt-admin.conf /var/log/weirdo-project/logs/etc/libvirt/libvirt-admin.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105199]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105199]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105202]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/libvirt.conf /var/log/weirdo-project/logs/etc/libvirt/libvirt.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105202]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105202]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105205]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtnwfilterd.conf /var/log/weirdo-project/logs/etc/libvirt/virtnwfilterd.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105205]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105205]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105208]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtlockd.conf /var/log/weirdo-project/logs/etc/libvirt/virtlockd.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105208]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105208]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105211]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtnodedevd.conf /var/log/weirdo-project/logs/etc/libvirt/virtnodedevd.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105211]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105211]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105214]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtsecretd.conf /var/log/weirdo-project/logs/etc/libvirt/virtsecretd.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105214]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105214]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105217]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/network.conf /var/log/weirdo-project/logs/etc/libvirt/network.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105217]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105217]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105220]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtnetworkd.conf /var/log/weirdo-project/logs/etc/libvirt/virtnetworkd.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105220]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105220]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105223]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtinterfaced.conf /var/log/weirdo-project/logs/etc/libvirt/virtinterfaced.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105223]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105223]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105226]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/qemu-lockd.conf /var/log/weirdo-project/logs/etc/libvirt/qemu-lockd.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105226]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105226]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105229]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/qemu.conf /var/log/weirdo-project/logs/etc/libvirt/qemu.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105229]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105229]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105232]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtqemud.conf /var/log/weirdo-project/logs/etc/libvirt/virtqemud.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105232]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105232]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105235]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtstoraged.conf /var/log/weirdo-project/logs/etc/libvirt/virtstoraged.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105235]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105235]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105238]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/virtproxyd.conf /var/log/weirdo-project/logs/etc/libvirt/virtproxyd.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105238]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105238]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:51 np0005642945.novalocal sudo[105241]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/libvirt/libvirtd.conf /var/log/weirdo-project/logs/etc/libvirt/libvirtd.conf.txt Mar 09 20:35:51 np0005642945.novalocal sudo[105241]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:51 np0005642945.novalocal sudo[105241]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105244]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/default.conf /var/log/weirdo-project/logs/etc/openvswitch/default.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105244]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105244]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105247]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/.conf.db.~lock~ /var/log/weirdo-project/logs/etc/openvswitch/.conf.db.~lock~.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105247]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105247]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105250]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/conf.db /var/log/weirdo-project/logs/etc/openvswitch/conf.db.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105250]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105250]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105253]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/system-id.conf /var/log/weirdo-project/logs/etc/openvswitch/system-id.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105253]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105253]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105256]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/ovnnb-req.pem /var/log/weirdo-project/logs/etc/openvswitch/ovnnb-req.pem.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105256]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105256]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105259]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/ovnnb-cert.pem /var/log/weirdo-project/logs/etc/openvswitch/ovnnb-cert.pem.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105259]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105259]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105262]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/ovnsb-req.pem /var/log/weirdo-project/logs/etc/openvswitch/ovnsb-req.pem.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105262]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105262]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105265]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/ovnsb-cert.pem /var/log/weirdo-project/logs/etc/openvswitch/ovnsb-cert.pem.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105265]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105265]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105268]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/ovncontroller-req.pem /var/log/weirdo-project/logs/etc/openvswitch/ovncontroller-req.pem.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105268]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105268]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105271]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/ovncontroller-cert.pem /var/log/weirdo-project/logs/etc/openvswitch/ovncontroller-cert.pem.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105271]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105271]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105274]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/ovncontroller-privkey.pem /var/log/weirdo-project/logs/etc/openvswitch/ovncontroller-privkey.pem.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105274]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105274]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105277]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/ovnnb-privkey.pem /var/log/weirdo-project/logs/etc/openvswitch/ovnnb-privkey.pem.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105277]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105277]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105280]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openvswitch/ovnsb-privkey.pem /var/log/weirdo-project/logs/etc/openvswitch/ovnsb-privkey.pem.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105280]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105280]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105283]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf/httpd.conf /var/log/weirdo-project/logs/etc/httpd/conf/httpd.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105283]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105283]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105286]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf/magic /var/log/weirdo-project/logs/etc/httpd/conf/magic.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105286]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105286]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105289]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf/ports.conf /var/log/weirdo-project/logs/etc/httpd/conf/ports.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105289]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105289]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105292]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-barbican_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-barbican_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105292]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105292]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105295]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-designate_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-designate_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105295]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105295]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105298]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-heat_api_cfn_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-heat_api_cfn_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105298]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105298]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105301]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-heat_api_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-heat_api_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105301]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105301]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105304]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-keystone_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-keystone_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105304]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105304]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105307]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-mistral_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-mistral_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105307]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105307]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105310]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-nova_api_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-nova_api_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105310]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105310]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105313]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-nova_metadata_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-nova_metadata_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105313]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105313]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105316]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-placement_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-placement_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105316]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105316]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105319]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/10-trove_wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/10-trove_wsgi.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105319]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105319]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105322]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/15-horizon_ssl_vhost.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/15-horizon_ssl_vhost.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105322]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105322]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105325]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/15-horizon_vhost.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/15-horizon_vhost.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105325]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105325]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105328]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.d/openstack-dashboard.conf /var/log/weirdo-project/logs/etc/httpd/conf.d/openstack-dashboard.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105328]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105328]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105331]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/access_compat.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/access_compat.load.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105331]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105331]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105334]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/actions.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/actions.load.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105334]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105334]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:52 np0005642945.novalocal sudo[105337]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/alias.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/alias.conf.txt Mar 09 20:35:52 np0005642945.novalocal sudo[105337]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:52 np0005642945.novalocal sudo[105337]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105340]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/alias.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/alias.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105340]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105340]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105343]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/auth_basic.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/auth_basic.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105343]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105343]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105346]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/auth_digest.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/auth_digest.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105346]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105346]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105349]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authn_anon.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authn_anon.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105349]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105349]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105352]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authn_core.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authn_core.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105352]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105352]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105355]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authn_dbm.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authn_dbm.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105355]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105355]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105358]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authn_file.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authn_file.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105358]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105358]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105361]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_core.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_core.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105361]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105361]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105364]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_dbm.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_dbm.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105364]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105364]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105367]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_groupfile.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_groupfile.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105367]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105367]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105370]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_host.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_host.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105370]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105370]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105373]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_owner.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_owner.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105373]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105373]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105376]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_user.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/authz_user.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105376]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105376]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105379]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/autoindex.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/autoindex.conf.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105379]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105379]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105382]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/autoindex.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/autoindex.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105382]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105382]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105385]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/cache.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/cache.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105385]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105385]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105388]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/cgi.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/cgi.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105388]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105388]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105391]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dav_fs.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dav_fs.conf.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105391]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105391]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105394]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dav_fs.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dav_fs.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105394]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105394]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105397]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dav.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dav.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105397]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105397]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105400]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/deflate.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/deflate.conf.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105400]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105400]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105403]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/deflate.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/deflate.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105403]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105403]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105406]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dir.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dir.conf.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105406]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105406]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105409]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dir.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/dir.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105409]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105409]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105412]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/env.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/env.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105412]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105412]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105415]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/expires.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/expires.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105415]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105415]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105418]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/ext_filter.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/ext_filter.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105418]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105418]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105421]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/filter.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/filter.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105421]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105421]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105424]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/headers.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/headers.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105424]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105424]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105427]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/include.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/include.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105427]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105427]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105430]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/log_config.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/log_config.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105430]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105430]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105433]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/logio.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/logio.load.txt Mar 09 20:35:53 np0005642945.novalocal sudo[105433]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:53 np0005642945.novalocal sudo[105433]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:53 np0005642945.novalocal sudo[105436]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/mime.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/mime.conf.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105436]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105436]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105439]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/mime.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/mime.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105439]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105439]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105442]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/mime_magic.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/mime_magic.conf.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105442]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105442]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105445]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/mime_magic.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/mime_magic.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105445]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105445]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105448]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/negotiation.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/negotiation.conf.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105448]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105448]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105451]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/negotiation.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/negotiation.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105451]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105451]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105454]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/prefork.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/prefork.conf.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105454]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105454]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105457]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/prefork.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/prefork.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105457]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105457]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105460]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/rewrite.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/rewrite.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105460]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105460]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105463]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/setenvif.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/setenvif.conf.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105463]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105463]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105466]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/setenvif.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/setenvif.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105466]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105466]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105469]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/socache_shmcb.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/socache_shmcb.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105469]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105469]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105472]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/speling.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/speling.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105472]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105472]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105475]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/ssl.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/ssl.conf.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105475]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105475]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105478]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/ssl.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/ssl.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105478]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105478]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105481]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/substitute.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/substitute.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105481]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105481]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105484]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/suexec.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/suexec.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105484]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105484]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105487]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/systemd.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/systemd.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105487]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105487]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105490]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/unixd.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/unixd.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105490]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105490]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105493]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/usertrack.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/usertrack.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105493]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105493]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105496]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/version.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/version.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105496]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105496]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105499]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/vhost_alias.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/vhost_alias.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105499]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105499]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105502]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/wsgi.conf /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/wsgi.conf.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105502]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105502]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105505]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/wsgi.load /var/log/weirdo-project/logs/etc/httpd/conf.modules.d/wsgi.load.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105505]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105505]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105508]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/redis/redis.conf /var/log/weirdo-project/logs/etc/redis/redis.conf.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105508]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105508]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105511]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/redis/sentinel.conf /var/log/weirdo-project/logs/etc/redis/sentinel.conf.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105511]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105511]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105514]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/redis/redis.conf.puppet /var/log/weirdo-project/logs/etc/redis/redis.conf.puppet.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105514]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105514]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105517]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/redis/ssl/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/redis/ssl/private/np0005642945.novalocal.pem.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105517]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105517]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105520]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/cinder_policy.yaml.txt /var/log/weirdo-project/logs/etc/openstack-dashboard/cinder_policy.yaml.txt.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105520]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105520]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105523]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/README.txt /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/README.txt.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105523]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105523]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105526]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/cinder.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/cinder.yaml.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105526]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:54 np0005642945.novalocal sudo[105526]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:54 np0005642945.novalocal sudo[105529]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/glance.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/glance.yaml.txt Mar 09 20:35:54 np0005642945.novalocal sudo[105529]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105529]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105532]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/keystone.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/keystone.yaml.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105532]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105532]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105535]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/neutron.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/neutron.yaml.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105535]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105535]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105538]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/nova.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/nova.yaml.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105538]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105538]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105541]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/heat.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/default_policies.txt/heat.yaml.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105541]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105541]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105544]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/glance_policy.yaml.txt /var/log/weirdo-project/logs/etc/openstack-dashboard/glance_policy.yaml.txt.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105544]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105544]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105547]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/heat_policy.yaml.txt /var/log/weirdo-project/logs/etc/openstack-dashboard/heat_policy.yaml.txt.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105547]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105547]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105550]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/keystone_policy.yaml.txt /var/log/weirdo-project/logs/etc/openstack-dashboard/keystone_policy.yaml.txt.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105550]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105550]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105553]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.txt /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.txt.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105553]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105553]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105556]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_10_set_custom_theme.py.example /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_10_set_custom_theme.py.example.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105556]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105556]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105559]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_11_toggle_angular_features.py.example /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_11_toggle_angular_features.py.example.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105559]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105559]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105562]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_2010_integration_tests_deprecated.py.example /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_2010_integration_tests_deprecated.py.example.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105562]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105562]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105565]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_20_integration_tests_scaffolds.py.example /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_20_integration_tests_scaffolds.py.example.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105565]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105565]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105568]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_9030_profiler_settings.py.example /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_9030_profiler_settings.py.example.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105568]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105568]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105571]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_1699_orchestration_settings.py /var/log/weirdo-project/logs/etc/openstack-dashboard/local_settings.d.txt/_1699_orchestration_settings.py.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105571]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105571]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105574]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/neutron_policy.yaml.txt /var/log/weirdo-project/logs/etc/openstack-dashboard/neutron_policy.yaml.txt.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105574]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105574]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105577]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/nova_policy.d.txt/api-extensions.yaml /var/log/weirdo-project/logs/etc/openstack-dashboard/nova_policy.d.txt/api-extensions.yaml.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105577]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105577]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105580]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/nova_policy.yaml.txt /var/log/weirdo-project/logs/etc/openstack-dashboard/nova_policy.yaml.txt.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105580]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105580]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105583]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack-dashboard/ssl.txt/private/np0005642945.novalocal.pem /var/log/weirdo-project/logs/etc/openstack-dashboard/ssl.txt/private/np0005642945.novalocal.pem.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105583]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105583]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105588]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/centos.repo /var/log/weirdo-project/logs/etc/yum.repos.d/centos.repo.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105588]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105588]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105591]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/redhat.repo /var/log/weirdo-project/logs/etc/yum.repos.d/redhat.repo.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105591]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105591]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105594]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-Storage-common.repo /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-Storage-common.repo.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105594]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105594]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105597]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-Ceph-Quincy.repo /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-Ceph-Quincy.repo.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105597]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105597]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105600]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-NFV-OpenvSwitch.repo /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-NFV-OpenvSwitch.repo.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105600]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105600]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105603]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-Messaging-rabbitmq.repo /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-Messaging-rabbitmq.repo.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105603]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105603]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105606]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-OpenStack-antelope.repo /var/log/weirdo-project/logs/etc/yum.repos.d/CentOS-OpenStack-antelope.repo.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105606]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105606]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105609]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/epel-cisco-openh264.repo.rpmsave /var/log/weirdo-project/logs/etc/yum.repos.d/epel-cisco-openh264.repo.rpmsave.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105609]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105609]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105612]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/epel.repo.rpmsave /var/log/weirdo-project/logs/etc/yum.repos.d/epel.repo.rpmsave.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105612]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105612]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105615]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/epel-next.repo.rpmsave /var/log/weirdo-project/logs/etc/yum.repos.d/epel-next.repo.rpmsave.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105615]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105615]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105618]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/yum.repos.d/centos-addons.repo /var/log/weirdo-project/logs/etc/yum.repos.d/centos-addons.repo.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105618]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105618]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105621]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/passwd /var/log/weirdo-project/logs/etc/passwd.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105621]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105621]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105624]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/group /var/log/weirdo-project/logs/etc/group.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105624]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105624]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105627]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/openstack/puppet/admin-clouds.yaml /var/log/weirdo-project/logs/etc/openstack/puppet/admin-clouds.yaml.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105627]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105627]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[105630]: root : PWD=/tmp/puppet-openstack ; USER=root ; COMMAND=/bin/mv /var/log/weirdo-project/logs/etc/fstab /var/log/weirdo-project/logs/etc/fstab.txt Mar 09 20:35:55 np0005642945.novalocal sudo[105630]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Mar 09 20:35:55 np0005642945.novalocal sudo[105630]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:55 np0005642945.novalocal sudo[101952]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:56 np0005642945.novalocal sudo[105737]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mmkmwezkwgkgkxsqwvwnnhcouompjotn ; /usr/bin/python3' Mar 09 20:35:56 np0005642945.novalocal sudo[105737]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:56 np0005642945.novalocal python3[105739]: ansible-command Invoked with creates=/var/log/weirdo/cpuinfo.txt _raw_params=cat /proc/cpuinfo >/var/log/weirdo/cpuinfo.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:56 np0005642945.novalocal sudo[105737]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:56 np0005642945.novalocal sudo[105745]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pnikdqumrwrifdnzihzzncmkuywhtmqh ; /usr/bin/python3' Mar 09 20:35:56 np0005642945.novalocal sudo[105745]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:56 np0005642945.novalocal python3[105747]: ansible-command Invoked with creates=/var/log/weirdo/df.txt _raw_params=df -h >/var/log/weirdo/df.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:56 np0005642945.novalocal sudo[105745]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:56 np0005642945.novalocal sudo[105752]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bqddmvaqsfveqmefmmjzqbxbixcjtcci ; /usr/bin/python3' Mar 09 20:35:56 np0005642945.novalocal sudo[105752]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:56 np0005642945.novalocal python3[105754]: ansible-command Invoked with creates=/var/log/weirdo/dmesg.txt _raw_params=dmesg -T >/var/log/weirdo/dmesg.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:56 np0005642945.novalocal sudo[105752]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:56 np0005642945.novalocal sudo[105759]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kdznsgpnwhonlqamsjmyenjltwkwyffg ; /usr/bin/python3' Mar 09 20:35:56 np0005642945.novalocal sudo[105759]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:57 np0005642945.novalocal python3[105761]: ansible-command Invoked with creates=/var/log/weirdo/fdisk.txt _raw_params=fdisk -l >/var/log/weirdo/fdisk.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:57 np0005642945.novalocal sudo[105759]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:57 np0005642945.novalocal sudo[105766]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cavwarmnpzjcamttbtxxwgbivxiqwfal ; /usr/bin/python3' Mar 09 20:35:57 np0005642945.novalocal sudo[105766]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:57 np0005642945.novalocal python3[105768]: ansible-command Invoked with creates=/var/log/weirdo/getenforce.txt _raw_params=getenforce >/var/log/weirdo/getenforce.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:57 np0005642945.novalocal sudo[105766]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:57 np0005642945.novalocal sudo[105773]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vcnetyntfzyjjafslvvknwajynjtvfmw ; /usr/bin/python3' Mar 09 20:35:57 np0005642945.novalocal sudo[105773]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:57 np0005642945.novalocal python3[105775]: ansible-command Invoked with creates=/var/log/weirdo/hosts.txt _raw_params=cat /etc/hosts >/var/log/weirdo/hosts.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:57 np0005642945.novalocal sudo[105773]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:57 np0005642945.novalocal sudo[105780]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gqvxlylnlkaefdurlkzyrkmzonzruixo ; /usr/bin/python3' Mar 09 20:35:57 np0005642945.novalocal sudo[105780]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:57 np0005642945.novalocal python3[105782]: ansible-command Invoked with creates=/var/log/weirdo/ip.txt _raw_params=ip a >/var/log/weirdo/ip.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:57 np0005642945.novalocal sudo[105780]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:57 np0005642945.novalocal sudo[105787]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qmvmenoimakbejnybohtvmuwhepmruva ; /usr/bin/python3' Mar 09 20:35:57 np0005642945.novalocal sudo[105787]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:58 np0005642945.novalocal python3[105789]: ansible-command Invoked with creates=/var/log/weirdo/iptables.txt _raw_params=iptables -vnL >/var/log/weirdo/iptables.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:58 np0005642945.novalocal sudo[105787]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:58 np0005642945.novalocal sudo[105794]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mysurqdwtkdmlziaemmvycqbdusgbooy ; /usr/bin/python3' Mar 09 20:35:58 np0005642945.novalocal sudo[105794]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:58 np0005642945.novalocal python3[105796]: ansible-command Invoked with creates=/var/log/weirdo/iptables_nat.txt _raw_params=iptables -vnL -t nat >/var/log/weirdo/iptables_nat.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:58 np0005642945.novalocal sudo[105794]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:58 np0005642945.novalocal sudo[105801]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xgjccryeljeqplnxjjzuzpeterfqqbpl ; /usr/bin/python3' Mar 09 20:35:58 np0005642945.novalocal sudo[105801]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:58 np0005642945.novalocal python3[105803]: ansible-command Invoked with creates=/var/log/weirdo/iptables_mangle.txt _raw_params=iptables -vnL -t mangle >/var/log/weirdo/iptables_mangle.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Mar 09 20:35:58 np0005642945.novalocal sudo[105801]: pam_unix(sudo:session): session closed for user root Mar 09 20:35:58 np0005642945.novalocal sudo[105808]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vltmcemgwyljuuobrddqwkvqqqmvyrnq ; /usr/bin/python3' Mar 09 20:35:58 np0005642945.novalocal sudo[105808]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Mar 09 20:35:58 np0005642945.novalocal python3[105810]: ansible-command Invoked with creates=/var/log/weirdo/journalctl.txt _raw_params=journalctl --no-pager >/var/log/weirdo/journalctl.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None