Feb 20 19:00:47 localhost kernel: Linux version 5.14.0-681.el9.x86_64 (mockbuild@x86-05.stream.rdu2.redhat.com) (gcc (GCC) 11.5.0 20240719 (Red Hat 11.5.0-14), GNU ld version 2.35.2-69.el9) #1 SMP PREEMPT_DYNAMIC Wed Feb 11 20:19:22 UTC 2026 Feb 20 19:00:47 localhost kernel: The list of certified hardware and cloud instances for Red Hat Enterprise Linux 9 can be viewed at the Red Hat Ecosystem Catalog, https://catalog.redhat.com. Feb 20 19:00:47 localhost kernel: Command line: BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-681.el9.x86_64 root=UUID=9d578f93-c4e9-4172-8459-ef150e54751c ro console=ttyS0,115200n8 no_timer_check net.ifnames=0 crashkernel=1G-2G:192M,2G-64G:256M,64G-:512M Feb 20 19:00:47 localhost kernel: BIOS-provided physical RAM map: Feb 20 19:00:47 localhost kernel: BIOS-e820: [mem 0x0000000000000000-0x000000000009fbff] usable Feb 20 19:00:47 localhost kernel: BIOS-e820: [mem 0x000000000009fc00-0x000000000009ffff] reserved Feb 20 19:00:47 localhost kernel: BIOS-e820: [mem 0x00000000000f0000-0x00000000000fffff] reserved Feb 20 19:00:47 localhost kernel: BIOS-e820: [mem 0x0000000000100000-0x00000000bffdafff] usable Feb 20 19:00:47 localhost kernel: BIOS-e820: [mem 0x00000000bffdb000-0x00000000bfffffff] reserved Feb 20 19:00:47 localhost kernel: BIOS-e820: [mem 0x00000000feffc000-0x00000000feffffff] reserved Feb 20 19:00:47 localhost kernel: BIOS-e820: [mem 0x00000000fffc0000-0x00000000ffffffff] reserved Feb 20 19:00:47 localhost kernel: BIOS-e820: [mem 0x0000000100000000-0x000000023fffffff] usable Feb 20 19:00:47 localhost kernel: NX (Execute Disable) protection: active Feb 20 19:00:47 localhost kernel: APIC: Static calls initialized Feb 20 19:00:47 localhost kernel: SMBIOS 2.8 present. Feb 20 19:00:47 localhost kernel: DMI: OpenStack Foundation OpenStack Nova, BIOS 1.15.0-1 04/01/2014 Feb 20 19:00:47 localhost kernel: Hypervisor detected: KVM Feb 20 19:00:47 localhost kernel: kvm-clock: Using msrs 4b564d01 and 4b564d00 Feb 20 19:00:47 localhost kernel: kvm-clock: using sched offset of 10894204199 cycles Feb 20 19:00:47 localhost kernel: clocksource: kvm-clock: mask: 0xffffffffffffffff max_cycles: 0x1cd42e4dffb, max_idle_ns: 881590591483 ns Feb 20 19:00:47 localhost kernel: tsc: Detected 2799.998 MHz processor Feb 20 19:00:47 localhost kernel: e820: update [mem 0x00000000-0x00000fff] usable ==> reserved Feb 20 19:00:47 localhost kernel: e820: remove [mem 0x000a0000-0x000fffff] usable Feb 20 19:00:47 localhost kernel: last_pfn = 0x240000 max_arch_pfn = 0x400000000 Feb 20 19:00:47 localhost kernel: MTRR map: 4 entries (3 fixed + 1 variable; max 19), built from 8 variable MTRRs Feb 20 19:00:47 localhost kernel: x86/PAT: Configuration [0-7]: WB WC UC- UC WB WP UC- WT Feb 20 19:00:47 localhost kernel: last_pfn = 0xbffdb max_arch_pfn = 0x400000000 Feb 20 19:00:47 localhost kernel: found SMP MP-table at [mem 0x000f5ae0-0x000f5aef] Feb 20 19:00:47 localhost kernel: Using GB pages for direct mapping Feb 20 19:00:47 localhost kernel: RAMDISK: [mem 0x1b6f6000-0x29b72fff] Feb 20 19:00:47 localhost kernel: ACPI: Early table checksum verification disabled Feb 20 19:00:47 localhost kernel: ACPI: RSDP 0x00000000000F5AA0 000014 (v00 BOCHS ) Feb 20 19:00:47 localhost kernel: ACPI: RSDT 0x00000000BFFE16BD 000030 (v01 BOCHS BXPC 00000001 BXPC 00000001) Feb 20 19:00:47 localhost kernel: ACPI: FACP 0x00000000BFFE1571 000074 (v01 BOCHS BXPC 00000001 BXPC 00000001) Feb 20 19:00:47 localhost kernel: ACPI: DSDT 0x00000000BFFDFC80 0018F1 (v01 BOCHS BXPC 00000001 BXPC 00000001) Feb 20 19:00:47 localhost kernel: ACPI: FACS 0x00000000BFFDFC40 000040 Feb 20 19:00:47 localhost kernel: ACPI: APIC 0x00000000BFFE15E5 0000B0 (v01 BOCHS BXPC 00000001 BXPC 00000001) Feb 20 19:00:47 localhost kernel: ACPI: WAET 0x00000000BFFE1695 000028 (v01 BOCHS BXPC 00000001 BXPC 00000001) Feb 20 19:00:47 localhost kernel: ACPI: Reserving FACP table memory at [mem 0xbffe1571-0xbffe15e4] Feb 20 19:00:47 localhost kernel: ACPI: Reserving DSDT table memory at [mem 0xbffdfc80-0xbffe1570] Feb 20 19:00:47 localhost kernel: ACPI: Reserving FACS table memory at [mem 0xbffdfc40-0xbffdfc7f] Feb 20 19:00:47 localhost kernel: ACPI: Reserving APIC table memory at [mem 0xbffe15e5-0xbffe1694] Feb 20 19:00:47 localhost kernel: ACPI: Reserving WAET table memory at [mem 0xbffe1695-0xbffe16bc] Feb 20 19:00:47 localhost kernel: No NUMA configuration found Feb 20 19:00:47 localhost kernel: Faking a node at [mem 0x0000000000000000-0x000000023fffffff] Feb 20 19:00:47 localhost kernel: NODE_DATA(0) allocated [mem 0x23ffd3000-0x23fffdfff] Feb 20 19:00:47 localhost kernel: crashkernel reserved: 0x00000000af000000 - 0x00000000bf000000 (256 MB) Feb 20 19:00:47 localhost kernel: Zone ranges: Feb 20 19:00:47 localhost kernel: DMA [mem 0x0000000000001000-0x0000000000ffffff] Feb 20 19:00:47 localhost kernel: DMA32 [mem 0x0000000001000000-0x00000000ffffffff] Feb 20 19:00:47 localhost kernel: Normal [mem 0x0000000100000000-0x000000023fffffff] Feb 20 19:00:47 localhost kernel: Device empty Feb 20 19:00:47 localhost kernel: Movable zone start for each node Feb 20 19:00:47 localhost kernel: Early memory node ranges Feb 20 19:00:47 localhost kernel: node 0: [mem 0x0000000000001000-0x000000000009efff] Feb 20 19:00:47 localhost kernel: node 0: [mem 0x0000000000100000-0x00000000bffdafff] Feb 20 19:00:47 localhost kernel: node 0: [mem 0x0000000100000000-0x000000023fffffff] Feb 20 19:00:47 localhost kernel: Initmem setup node 0 [mem 0x0000000000001000-0x000000023fffffff] Feb 20 19:00:47 localhost kernel: On node 0, zone DMA: 1 pages in unavailable ranges Feb 20 19:00:47 localhost kernel: On node 0, zone DMA: 97 pages in unavailable ranges Feb 20 19:00:47 localhost kernel: On node 0, zone Normal: 37 pages in unavailable ranges Feb 20 19:00:47 localhost kernel: ACPI: PM-Timer IO Port: 0x608 Feb 20 19:00:47 localhost kernel: ACPI: LAPIC_NMI (acpi_id[0xff] dfl dfl lint[0x1]) Feb 20 19:00:47 localhost kernel: IOAPIC[0]: apic_id 0, version 17, address 0xfec00000, GSI 0-23 Feb 20 19:00:47 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl) Feb 20 19:00:47 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 5 global_irq 5 high level) Feb 20 19:00:47 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level) Feb 20 19:00:47 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 10 global_irq 10 high level) Feb 20 19:00:47 localhost kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 11 global_irq 11 high level) Feb 20 19:00:47 localhost kernel: ACPI: Using ACPI (MADT) for SMP configuration information Feb 20 19:00:47 localhost kernel: TSC deadline timer available Feb 20 19:00:47 localhost kernel: CPU topo: Max. logical packages: 8 Feb 20 19:00:47 localhost kernel: CPU topo: Max. logical dies: 8 Feb 20 19:00:47 localhost kernel: CPU topo: Max. dies per package: 1 Feb 20 19:00:47 localhost kernel: CPU topo: Max. threads per core: 1 Feb 20 19:00:47 localhost kernel: CPU topo: Num. cores per package: 1 Feb 20 19:00:47 localhost kernel: CPU topo: Num. threads per package: 1 Feb 20 19:00:47 localhost kernel: CPU topo: Allowing 8 present CPUs plus 0 hotplug CPUs Feb 20 19:00:47 localhost kernel: kvm-guest: APIC: eoi() replaced with kvm_guest_apic_eoi_write() Feb 20 19:00:47 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0x00000000-0x00000fff] Feb 20 19:00:47 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0x0009f000-0x0009ffff] Feb 20 19:00:47 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0x000a0000-0x000effff] Feb 20 19:00:47 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0x000f0000-0x000fffff] Feb 20 19:00:47 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xbffdb000-0xbfffffff] Feb 20 19:00:47 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xc0000000-0xfeffbfff] Feb 20 19:00:47 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xfeffc000-0xfeffffff] Feb 20 19:00:47 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xff000000-0xfffbffff] Feb 20 19:00:47 localhost kernel: PM: hibernation: Registered nosave memory: [mem 0xfffc0000-0xffffffff] Feb 20 19:00:47 localhost kernel: [mem 0xc0000000-0xfeffbfff] available for PCI devices Feb 20 19:00:47 localhost kernel: Booting paravirtualized kernel on KVM Feb 20 19:00:47 localhost kernel: clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1910969940391419 ns Feb 20 19:00:47 localhost kernel: setup_percpu: NR_CPUS:8192 nr_cpumask_bits:8 nr_cpu_ids:8 nr_node_ids:1 Feb 20 19:00:47 localhost kernel: percpu: Embedded 64 pages/cpu s225280 r8192 d28672 u262144 Feb 20 19:00:47 localhost kernel: pcpu-alloc: s225280 r8192 d28672 u262144 alloc=1*2097152 Feb 20 19:00:47 localhost kernel: pcpu-alloc: [0] 0 1 2 3 4 5 6 7 Feb 20 19:00:47 localhost kernel: kvm-guest: PV spinlocks disabled, no host support Feb 20 19:00:47 localhost kernel: Kernel command line: BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-681.el9.x86_64 root=UUID=9d578f93-c4e9-4172-8459-ef150e54751c ro console=ttyS0,115200n8 no_timer_check net.ifnames=0 crashkernel=1G-2G:192M,2G-64G:256M,64G-:512M Feb 20 19:00:47 localhost kernel: Unknown kernel command line parameters "BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-681.el9.x86_64", will be passed to user space. Feb 20 19:00:47 localhost kernel: random: crng init done Feb 20 19:00:47 localhost kernel: Dentry cache hash table entries: 1048576 (order: 11, 8388608 bytes, linear) Feb 20 19:00:47 localhost kernel: Inode-cache hash table entries: 524288 (order: 10, 4194304 bytes, linear) Feb 20 19:00:47 localhost kernel: Fallback order for Node 0: 0 Feb 20 19:00:47 localhost kernel: Built 1 zonelists, mobility grouping on. Total pages: 2064091 Feb 20 19:00:47 localhost kernel: Policy zone: Normal Feb 20 19:00:47 localhost kernel: mem auto-init: stack:off, heap alloc:off, heap free:off Feb 20 19:00:47 localhost kernel: software IO TLB: area num 8. Feb 20 19:00:47 localhost kernel: SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=8, Nodes=1 Feb 20 19:00:47 localhost kernel: ftrace: allocating 49565 entries in 194 pages Feb 20 19:00:47 localhost kernel: ftrace: allocated 194 pages with 3 groups Feb 20 19:00:47 localhost kernel: Dynamic Preempt: voluntary Feb 20 19:00:47 localhost kernel: rcu: Preemptible hierarchical RCU implementation. Feb 20 19:00:47 localhost kernel: rcu: RCU event tracing is enabled. Feb 20 19:00:47 localhost kernel: rcu: RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=8. Feb 20 19:00:47 localhost kernel: Trampoline variant of Tasks RCU enabled. Feb 20 19:00:47 localhost kernel: Rude variant of Tasks RCU enabled. Feb 20 19:00:47 localhost kernel: Tracing variant of Tasks RCU enabled. Feb 20 19:00:47 localhost kernel: rcu: RCU calculated value of scheduler-enlistment delay is 100 jiffies. Feb 20 19:00:47 localhost kernel: rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=8 Feb 20 19:00:47 localhost kernel: RCU Tasks: Setting shift to 3 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=8. Feb 20 19:00:47 localhost kernel: RCU Tasks Rude: Setting shift to 3 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=8. Feb 20 19:00:47 localhost kernel: RCU Tasks Trace: Setting shift to 3 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=8. Feb 20 19:00:47 localhost kernel: NR_IRQS: 524544, nr_irqs: 488, preallocated irqs: 16 Feb 20 19:00:47 localhost kernel: rcu: srcu_init: Setting srcu_struct sizes based on contention. Feb 20 19:00:47 localhost kernel: kfence: initialized - using 2097152 bytes for 255 objects at 0x(____ptrval____)-0x(____ptrval____) Feb 20 19:00:47 localhost kernel: Console: colour VGA+ 80x25 Feb 20 19:00:47 localhost kernel: printk: console [ttyS0] enabled Feb 20 19:00:47 localhost kernel: ACPI: Core revision 20230331 Feb 20 19:00:47 localhost kernel: APIC: Switch to symmetric I/O mode setup Feb 20 19:00:47 localhost kernel: x2apic enabled Feb 20 19:00:47 localhost kernel: APIC: Switched APIC routing to: physical x2apic Feb 20 19:00:47 localhost kernel: tsc: Marking TSC unstable due to TSCs unsynchronized Feb 20 19:00:47 localhost kernel: Calibrating delay loop (skipped) preset value.. 5599.99 BogoMIPS (lpj=2799998) Feb 20 19:00:47 localhost kernel: x86/cpu: User Mode Instruction Prevention (UMIP) activated Feb 20 19:00:47 localhost kernel: Last level iTLB entries: 4KB 512, 2MB 255, 4MB 127 Feb 20 19:00:47 localhost kernel: Last level dTLB entries: 4KB 512, 2MB 255, 4MB 127, 1GB 0 Feb 20 19:00:47 localhost kernel: mitigations: Enabled attack vectors: user_kernel, user_user, guest_host, guest_guest, SMT mitigations: auto Feb 20 19:00:47 localhost kernel: Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl Feb 20 19:00:47 localhost kernel: Spectre V2 : Mitigation: Retpolines Feb 20 19:00:47 localhost kernel: RETBleed: Mitigation: untrained return thunk Feb 20 19:00:47 localhost kernel: Speculative Return Stack Overflow: Mitigation: SMT disabled Feb 20 19:00:47 localhost kernel: Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization Feb 20 19:00:47 localhost kernel: Spectre V2 : Spectre v2 / SpectreRSB: Filling RSB on context switch and VMEXIT Feb 20 19:00:47 localhost kernel: Spectre V2 : Enabling Speculation Barrier for firmware calls Feb 20 19:00:47 localhost kernel: active return thunk: retbleed_return_thunk Feb 20 19:00:47 localhost kernel: Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier Feb 20 19:00:47 localhost kernel: x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers' Feb 20 19:00:47 localhost kernel: x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers' Feb 20 19:00:47 localhost kernel: x86/fpu: Supporting XSAVE feature 0x004: 'AVX registers' Feb 20 19:00:47 localhost kernel: x86/fpu: xstate_offset[2]: 576, xstate_sizes[2]: 256 Feb 20 19:00:47 localhost kernel: x86/fpu: Enabled xstate features 0x7, context size is 832 bytes, using 'compacted' format. Feb 20 19:00:47 localhost kernel: Freeing SMP alternatives memory: 40K Feb 20 19:00:47 localhost kernel: pid_max: default: 32768 minimum: 301 Feb 20 19:00:47 localhost kernel: LSM: initializing lsm=lockdown,capability,landlock,yama,integrity,selinux,bpf Feb 20 19:00:47 localhost kernel: landlock: Up and running. Feb 20 19:00:47 localhost kernel: Yama: becoming mindful. Feb 20 19:00:47 localhost kernel: SELinux: Initializing. Feb 20 19:00:47 localhost kernel: LSM support for eBPF active Feb 20 19:00:47 localhost kernel: Mount-cache hash table entries: 16384 (order: 5, 131072 bytes, linear) Feb 20 19:00:47 localhost kernel: Mountpoint-cache hash table entries: 16384 (order: 5, 131072 bytes, linear) Feb 20 19:00:47 localhost kernel: smpboot: CPU0: AMD EPYC-Rome Processor (family: 0x17, model: 0x31, stepping: 0x0) Feb 20 19:00:47 localhost kernel: Performance Events: Fam17h+ core perfctr, AMD PMU driver. Feb 20 19:00:47 localhost kernel: ... version: 0 Feb 20 19:00:47 localhost kernel: ... bit width: 48 Feb 20 19:00:47 localhost kernel: ... generic registers: 6 Feb 20 19:00:47 localhost kernel: ... value mask: 0000ffffffffffff Feb 20 19:00:47 localhost kernel: ... max period: 00007fffffffffff Feb 20 19:00:47 localhost kernel: ... fixed-purpose events: 0 Feb 20 19:00:47 localhost kernel: ... event mask: 000000000000003f Feb 20 19:00:47 localhost kernel: signal: max sigframe size: 1776 Feb 20 19:00:47 localhost kernel: rcu: Hierarchical SRCU implementation. Feb 20 19:00:47 localhost kernel: rcu: Max phase no-delay instances is 400. Feb 20 19:00:47 localhost kernel: smp: Bringing up secondary CPUs ... Feb 20 19:00:47 localhost kernel: smpboot: x86: Booting SMP configuration: Feb 20 19:00:47 localhost kernel: .... node #0, CPUs: #1 #2 #3 #4 #5 #6 #7 Feb 20 19:00:47 localhost kernel: smp: Brought up 1 node, 8 CPUs Feb 20 19:00:47 localhost kernel: smpboot: Total of 8 processors activated (44799.96 BogoMIPS) Feb 20 19:00:47 localhost kernel: node 0 deferred pages initialised in 10ms Feb 20 19:00:47 localhost kernel: Memory: 7617940K/8388068K available (16384K kernel code, 5795K rwdata, 13948K rodata, 4204K init, 7180K bss, 764384K reserved, 0K cma-reserved) Feb 20 19:00:47 localhost kernel: devtmpfs: initialized Feb 20 19:00:47 localhost kernel: x86/mm: Memory block size: 128MB Feb 20 19:00:47 localhost kernel: clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1911260446275000 ns Feb 20 19:00:47 localhost kernel: futex hash table entries: 2048 (131072 bytes on 1 NUMA nodes, total 128 KiB, linear). Feb 20 19:00:47 localhost kernel: pinctrl core: initialized pinctrl subsystem Feb 20 19:00:47 localhost kernel: NET: Registered PF_NETLINK/PF_ROUTE protocol family Feb 20 19:00:47 localhost kernel: DMA: preallocated 1024 KiB GFP_KERNEL pool for atomic allocations Feb 20 19:00:47 localhost kernel: DMA: preallocated 1024 KiB GFP_KERNEL|GFP_DMA pool for atomic allocations Feb 20 19:00:47 localhost kernel: DMA: preallocated 1024 KiB GFP_KERNEL|GFP_DMA32 pool for atomic allocations Feb 20 19:00:47 localhost kernel: audit: initializing netlink subsys (disabled) Feb 20 19:00:47 localhost kernel: audit: type=2000 audit(1771632046.157:1): state=initialized audit_enabled=0 res=1 Feb 20 19:00:47 localhost kernel: thermal_sys: Registered thermal governor 'fair_share' Feb 20 19:00:47 localhost kernel: thermal_sys: Registered thermal governor 'step_wise' Feb 20 19:00:47 localhost kernel: thermal_sys: Registered thermal governor 'user_space' Feb 20 19:00:47 localhost kernel: cpuidle: using governor menu Feb 20 19:00:47 localhost kernel: acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5 Feb 20 19:00:47 localhost kernel: PCI: Using configuration type 1 for base access Feb 20 19:00:47 localhost kernel: PCI: Using configuration type 1 for extended access Feb 20 19:00:47 localhost kernel: kprobes: kprobe jump-optimization is enabled. All kprobes are optimized if possible. Feb 20 19:00:47 localhost kernel: HugeTLB: registered 1.00 GiB page size, pre-allocated 0 pages Feb 20 19:00:47 localhost kernel: HugeTLB: 16380 KiB vmemmap can be freed for a 1.00 GiB page Feb 20 19:00:47 localhost kernel: HugeTLB: registered 2.00 MiB page size, pre-allocated 0 pages Feb 20 19:00:47 localhost kernel: HugeTLB: 28 KiB vmemmap can be freed for a 2.00 MiB page Feb 20 19:00:47 localhost kernel: Demotion targets for Node 0: null Feb 20 19:00:47 localhost kernel: cryptd: max_cpu_qlen set to 1000 Feb 20 19:00:47 localhost kernel: ACPI: Added _OSI(Module Device) Feb 20 19:00:47 localhost kernel: ACPI: Added _OSI(Processor Device) Feb 20 19:00:47 localhost kernel: ACPI: Added _OSI(Processor Aggregator Device) Feb 20 19:00:47 localhost kernel: ACPI: 1 ACPI AML tables successfully acquired and loaded Feb 20 19:00:47 localhost kernel: ACPI: Interpreter enabled Feb 20 19:00:47 localhost kernel: ACPI: PM: (supports S0 S3 S4 S5) Feb 20 19:00:47 localhost kernel: ACPI: Using IOAPIC for interrupt routing Feb 20 19:00:47 localhost kernel: PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug Feb 20 19:00:47 localhost kernel: PCI: Using E820 reservations for host bridge windows Feb 20 19:00:47 localhost kernel: ACPI: Enabled 2 GPEs in block 00 to 0F Feb 20 19:00:47 localhost kernel: ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff]) Feb 20 19:00:47 localhost kernel: acpi PNP0A03:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI EDR HPX-Type3] Feb 20 19:00:47 localhost kernel: acpiphp: Slot [3] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [4] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [5] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [6] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [7] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [8] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [9] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [10] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [11] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [12] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [13] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [14] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [15] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [16] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [17] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [18] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [19] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [20] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [21] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [22] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [23] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [24] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [25] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [26] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [27] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [28] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [29] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [30] registered Feb 20 19:00:47 localhost kernel: acpiphp: Slot [31] registered Feb 20 19:00:47 localhost kernel: PCI host bridge to bus 0000:00 Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: root bus resource [io 0x0000-0x0cf7 window] Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: root bus resource [io 0x0d00-0xffff window] Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window] Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: root bus resource [mem 0xc0000000-0xfebfffff window] Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: root bus resource [mem 0x240000000-0x2bfffffff window] Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: root bus resource [bus 00-ff] Feb 20 19:00:47 localhost kernel: pci 0000:00:00.0: [8086:1237] type 00 class 0x060000 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:01.0: [8086:7000] type 00 class 0x060100 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:01.1: [8086:7010] type 00 class 0x010180 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:01.1: BAR 4 [io 0xc140-0xc14f] Feb 20 19:00:47 localhost kernel: pci 0000:00:01.1: BAR 0 [io 0x01f0-0x01f7]: legacy IDE quirk Feb 20 19:00:47 localhost kernel: pci 0000:00:01.1: BAR 1 [io 0x03f6]: legacy IDE quirk Feb 20 19:00:47 localhost kernel: pci 0000:00:01.1: BAR 2 [io 0x0170-0x0177]: legacy IDE quirk Feb 20 19:00:47 localhost kernel: pci 0000:00:01.1: BAR 3 [io 0x0376]: legacy IDE quirk Feb 20 19:00:47 localhost kernel: pci 0000:00:01.2: [8086:7020] type 00 class 0x0c0300 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:01.2: BAR 4 [io 0xc100-0xc11f] Feb 20 19:00:47 localhost kernel: pci 0000:00:01.3: [8086:7113] type 00 class 0x068000 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:01.3: quirk: [io 0x0600-0x063f] claimed by PIIX4 ACPI Feb 20 19:00:47 localhost kernel: pci 0000:00:01.3: quirk: [io 0x0700-0x070f] claimed by PIIX4 SMB Feb 20 19:00:47 localhost kernel: pci 0000:00:02.0: [1af4:1050] type 00 class 0x030000 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:02.0: BAR 0 [mem 0xfe000000-0xfe7fffff pref] Feb 20 19:00:47 localhost kernel: pci 0000:00:02.0: BAR 2 [mem 0xfe800000-0xfe803fff 64bit pref] Feb 20 19:00:47 localhost kernel: pci 0000:00:02.0: BAR 4 [mem 0xfeb90000-0xfeb90fff] Feb 20 19:00:47 localhost kernel: pci 0000:00:02.0: ROM [mem 0xfeb80000-0xfeb8ffff pref] Feb 20 19:00:47 localhost kernel: pci 0000:00:02.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff] Feb 20 19:00:47 localhost kernel: pci 0000:00:03.0: [1af4:1000] type 00 class 0x020000 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:03.0: BAR 0 [io 0xc080-0xc0bf] Feb 20 19:00:47 localhost kernel: pci 0000:00:03.0: BAR 1 [mem 0xfeb91000-0xfeb91fff] Feb 20 19:00:47 localhost kernel: pci 0000:00:03.0: BAR 4 [mem 0xfe804000-0xfe807fff 64bit pref] Feb 20 19:00:47 localhost kernel: pci 0000:00:03.0: ROM [mem 0xfeb00000-0xfeb7ffff pref] Feb 20 19:00:47 localhost kernel: pci 0000:00:04.0: [1af4:1001] type 00 class 0x010000 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:04.0: BAR 0 [io 0xc000-0xc07f] Feb 20 19:00:47 localhost kernel: pci 0000:00:04.0: BAR 1 [mem 0xfeb92000-0xfeb92fff] Feb 20 19:00:47 localhost kernel: pci 0000:00:04.0: BAR 4 [mem 0xfe808000-0xfe80bfff 64bit pref] Feb 20 19:00:47 localhost kernel: pci 0000:00:05.0: [1af4:1002] type 00 class 0x00ff00 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:05.0: BAR 0 [io 0xc0c0-0xc0ff] Feb 20 19:00:47 localhost kernel: pci 0000:00:05.0: BAR 4 [mem 0xfe80c000-0xfe80ffff 64bit pref] Feb 20 19:00:47 localhost kernel: pci 0000:00:06.0: [1af4:1005] type 00 class 0x00ff00 conventional PCI endpoint Feb 20 19:00:47 localhost kernel: pci 0000:00:06.0: BAR 0 [io 0xc120-0xc13f] Feb 20 19:00:47 localhost kernel: pci 0000:00:06.0: BAR 4 [mem 0xfe810000-0xfe813fff 64bit pref] Feb 20 19:00:47 localhost kernel: ACPI: PCI: Interrupt link LNKA configured for IRQ 10 Feb 20 19:00:47 localhost kernel: ACPI: PCI: Interrupt link LNKB configured for IRQ 10 Feb 20 19:00:47 localhost kernel: ACPI: PCI: Interrupt link LNKC configured for IRQ 11 Feb 20 19:00:47 localhost kernel: ACPI: PCI: Interrupt link LNKD configured for IRQ 11 Feb 20 19:00:47 localhost kernel: ACPI: PCI: Interrupt link LNKS configured for IRQ 9 Feb 20 19:00:47 localhost kernel: iommu: Default domain type: Translated Feb 20 19:00:47 localhost kernel: iommu: DMA domain TLB invalidation policy: lazy mode Feb 20 19:00:47 localhost kernel: SCSI subsystem initialized Feb 20 19:00:47 localhost kernel: ACPI: bus type USB registered Feb 20 19:00:47 localhost kernel: usbcore: registered new interface driver usbfs Feb 20 19:00:47 localhost kernel: usbcore: registered new interface driver hub Feb 20 19:00:47 localhost kernel: usbcore: registered new device driver usb Feb 20 19:00:47 localhost kernel: pps_core: LinuxPPS API ver. 1 registered Feb 20 19:00:47 localhost kernel: pps_core: Software ver. 5.3.6 - Copyright 2005-2007 Rodolfo Giometti Feb 20 19:00:47 localhost kernel: PTP clock support registered Feb 20 19:00:47 localhost kernel: EDAC MC: Ver: 3.0.0 Feb 20 19:00:47 localhost kernel: NetLabel: Initializing Feb 20 19:00:47 localhost kernel: NetLabel: domain hash size = 128 Feb 20 19:00:47 localhost kernel: NetLabel: protocols = UNLABELED CIPSOv4 CALIPSO Feb 20 19:00:47 localhost kernel: NetLabel: unlabeled traffic allowed by default Feb 20 19:00:47 localhost kernel: PCI: Using ACPI for IRQ routing Feb 20 19:00:47 localhost kernel: PCI: pci_cache_line_size set to 64 bytes Feb 20 19:00:47 localhost kernel: e820: reserve RAM buffer [mem 0x0009fc00-0x0009ffff] Feb 20 19:00:47 localhost kernel: e820: reserve RAM buffer [mem 0xbffdb000-0xbfffffff] Feb 20 19:00:47 localhost kernel: pci 0000:00:02.0: vgaarb: setting as boot VGA device Feb 20 19:00:47 localhost kernel: pci 0000:00:02.0: vgaarb: bridge control possible Feb 20 19:00:47 localhost kernel: pci 0000:00:02.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none Feb 20 19:00:47 localhost kernel: vgaarb: loaded Feb 20 19:00:47 localhost kernel: clocksource: Switched to clocksource kvm-clock Feb 20 19:00:47 localhost kernel: VFS: Disk quotas dquot_6.6.0 Feb 20 19:00:47 localhost kernel: VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes) Feb 20 19:00:47 localhost kernel: pnp: PnP ACPI init Feb 20 19:00:47 localhost kernel: pnp 00:03: [dma 2] Feb 20 19:00:47 localhost kernel: pnp: PnP ACPI: found 5 devices Feb 20 19:00:47 localhost kernel: clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns Feb 20 19:00:47 localhost kernel: NET: Registered PF_INET protocol family Feb 20 19:00:47 localhost kernel: IP idents hash table entries: 131072 (order: 8, 1048576 bytes, linear) Feb 20 19:00:47 localhost kernel: tcp_listen_portaddr_hash hash table entries: 4096 (order: 4, 65536 bytes, linear) Feb 20 19:00:47 localhost kernel: Table-perturb hash table entries: 65536 (order: 6, 262144 bytes, linear) Feb 20 19:00:47 localhost kernel: TCP established hash table entries: 65536 (order: 7, 524288 bytes, linear) Feb 20 19:00:47 localhost kernel: TCP bind hash table entries: 65536 (order: 8, 1048576 bytes, linear) Feb 20 19:00:47 localhost kernel: TCP: Hash tables configured (established 65536 bind 65536) Feb 20 19:00:47 localhost kernel: MPTCP token hash table entries: 8192 (order: 5, 196608 bytes, linear) Feb 20 19:00:47 localhost kernel: UDP hash table entries: 4096 (order: 5, 131072 bytes, linear) Feb 20 19:00:47 localhost kernel: UDP-Lite hash table entries: 4096 (order: 5, 131072 bytes, linear) Feb 20 19:00:47 localhost kernel: NET: Registered PF_UNIX/PF_LOCAL protocol family Feb 20 19:00:47 localhost kernel: NET: Registered PF_XDP protocol family Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: resource 4 [io 0x0000-0x0cf7 window] Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: resource 5 [io 0x0d00-0xffff window] Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: resource 6 [mem 0x000a0000-0x000bffff window] Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: resource 7 [mem 0xc0000000-0xfebfffff window] Feb 20 19:00:47 localhost kernel: pci_bus 0000:00: resource 8 [mem 0x240000000-0x2bfffffff window] Feb 20 19:00:47 localhost kernel: pci 0000:00:01.0: PIIX3: Enabling Passive Release Feb 20 19:00:47 localhost kernel: pci 0000:00:00.0: Limiting direct PCI/PCI transfers Feb 20 19:00:47 localhost kernel: ACPI: \_SB_.LNKD: Enabled at IRQ 11 Feb 20 19:00:47 localhost kernel: pci 0000:00:01.2: quirk_usb_early_handoff+0x0/0x160 took 49976 usecs Feb 20 19:00:47 localhost kernel: PCI: CLS 0 bytes, default 64 Feb 20 19:00:47 localhost kernel: PCI-DMA: Using software bounce buffering for IO (SWIOTLB) Feb 20 19:00:47 localhost kernel: software IO TLB: mapped [mem 0x00000000a5000000-0x00000000a9000000] (64MB) Feb 20 19:00:47 localhost kernel: Trying to unpack rootfs image as initramfs... Feb 20 19:00:47 localhost kernel: ACPI: bus type thunderbolt registered Feb 20 19:00:47 localhost kernel: Initialise system trusted keyrings Feb 20 19:00:47 localhost kernel: Key type blacklist registered Feb 20 19:00:47 localhost kernel: workingset: timestamp_bits=36 max_order=21 bucket_order=0 Feb 20 19:00:47 localhost kernel: zbud: loaded Feb 20 19:00:47 localhost kernel: integrity: Platform Keyring initialized Feb 20 19:00:47 localhost kernel: integrity: Machine keyring initialized Feb 20 19:00:47 localhost kernel: Freeing initrd memory: 233972K Feb 20 19:00:47 localhost kernel: NET: Registered PF_ALG protocol family Feb 20 19:00:47 localhost kernel: xor: automatically using best checksumming function avx Feb 20 19:00:47 localhost kernel: Key type asymmetric registered Feb 20 19:00:47 localhost kernel: Asymmetric key parser 'x509' registered Feb 20 19:00:47 localhost kernel: Block layer SCSI generic (bsg) driver version 0.4 loaded (major 246) Feb 20 19:00:47 localhost kernel: io scheduler mq-deadline registered Feb 20 19:00:47 localhost kernel: io scheduler kyber registered Feb 20 19:00:47 localhost kernel: io scheduler bfq registered Feb 20 19:00:47 localhost kernel: atomic64_test: passed for x86-64 platform with CX8 and with SSE Feb 20 19:00:47 localhost kernel: shpchp: Standard Hot Plug PCI Controller Driver version: 0.4 Feb 20 19:00:47 localhost kernel: input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input0 Feb 20 19:00:47 localhost kernel: ACPI: button: Power Button [PWRF] Feb 20 19:00:47 localhost kernel: ACPI: \_SB_.LNKB: Enabled at IRQ 10 Feb 20 19:00:47 localhost kernel: ACPI: \_SB_.LNKC: Enabled at IRQ 11 Feb 20 19:00:47 localhost kernel: ACPI: \_SB_.LNKA: Enabled at IRQ 10 Feb 20 19:00:47 localhost kernel: Serial: 8250/16550 driver, 4 ports, IRQ sharing enabled Feb 20 19:00:47 localhost kernel: 00:00: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A Feb 20 19:00:47 localhost kernel: Non-volatile memory driver v1.3 Feb 20 19:00:47 localhost kernel: rdac: device handler registered Feb 20 19:00:47 localhost kernel: hp_sw: device handler registered Feb 20 19:00:47 localhost kernel: emc: device handler registered Feb 20 19:00:47 localhost kernel: alua: device handler registered Feb 20 19:00:47 localhost kernel: uhci_hcd 0000:00:01.2: UHCI Host Controller Feb 20 19:00:47 localhost kernel: uhci_hcd 0000:00:01.2: new USB bus registered, assigned bus number 1 Feb 20 19:00:47 localhost kernel: uhci_hcd 0000:00:01.2: detected 2 ports Feb 20 19:00:47 localhost kernel: uhci_hcd 0000:00:01.2: irq 11, io port 0x0000c100 Feb 20 19:00:47 localhost kernel: usb usb1: New USB device found, idVendor=1d6b, idProduct=0001, bcdDevice= 5.14 Feb 20 19:00:47 localhost kernel: usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1 Feb 20 19:00:47 localhost kernel: usb usb1: Product: UHCI Host Controller Feb 20 19:00:47 localhost kernel: usb usb1: Manufacturer: Linux 5.14.0-681.el9.x86_64 uhci_hcd Feb 20 19:00:47 localhost kernel: usb usb1: SerialNumber: 0000:00:01.2 Feb 20 19:00:47 localhost kernel: hub 1-0:1.0: USB hub found Feb 20 19:00:47 localhost kernel: hub 1-0:1.0: 2 ports detected Feb 20 19:00:47 localhost kernel: usbcore: registered new interface driver usbserial_generic Feb 20 19:00:47 localhost kernel: usbserial: USB Serial support registered for generic Feb 20 19:00:47 localhost kernel: i8042: PNP: PS/2 Controller [PNP0303:KBD,PNP0f13:MOU] at 0x60,0x64 irq 1,12 Feb 20 19:00:47 localhost kernel: serio: i8042 KBD port at 0x60,0x64 irq 1 Feb 20 19:00:47 localhost kernel: serio: i8042 AUX port at 0x60,0x64 irq 12 Feb 20 19:00:47 localhost kernel: mousedev: PS/2 mouse device common for all mice Feb 20 19:00:47 localhost kernel: rtc_cmos 00:04: RTC can wake from S4 Feb 20 19:00:47 localhost kernel: input: AT Translated Set 2 keyboard as /devices/platform/i8042/serio0/input/input1 Feb 20 19:00:47 localhost kernel: rtc_cmos 00:04: registered as rtc0 Feb 20 19:00:47 localhost kernel: rtc_cmos 00:04: setting system clock to 2026-02-21T00:00:46 UTC (1771632046) Feb 20 19:00:47 localhost kernel: rtc_cmos 00:04: alarms up to one day, y3k, 242 bytes nvram Feb 20 19:00:47 localhost kernel: amd_pstate: the _CPC object is not present in SBIOS or ACPI disabled Feb 20 19:00:47 localhost kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input4 Feb 20 19:00:47 localhost kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input3 Feb 20 19:00:47 localhost kernel: hid: raw HID events driver (C) Jiri Kosina Feb 20 19:00:47 localhost kernel: usbcore: registered new interface driver usbhid Feb 20 19:00:47 localhost kernel: usbhid: USB HID core driver Feb 20 19:00:47 localhost kernel: drop_monitor: Initializing network drop monitor service Feb 20 19:00:47 localhost kernel: Initializing XFRM netlink socket Feb 20 19:00:47 localhost kernel: NET: Registered PF_INET6 protocol family Feb 20 19:00:47 localhost kernel: Segment Routing with IPv6 Feb 20 19:00:47 localhost kernel: NET: Registered PF_PACKET protocol family Feb 20 19:00:47 localhost kernel: mpls_gso: MPLS GSO support Feb 20 19:00:47 localhost kernel: IPI shorthand broadcast: enabled Feb 20 19:00:47 localhost kernel: AVX2 version of gcm_enc/dec engaged. Feb 20 19:00:47 localhost kernel: AES CTR mode by8 optimization enabled Feb 20 19:00:47 localhost kernel: sched_clock: Marking stable (1266007013, 141355650)->(1472413316, -65050653) Feb 20 19:00:47 localhost kernel: registered taskstats version 1 Feb 20 19:00:47 localhost kernel: Loading compiled-in X.509 certificates Feb 20 19:00:47 localhost kernel: Loaded X.509 cert 'The CentOS Project: CentOS Stream kernel signing key: 4fde1469d8033882223ec575c1a1c1b88c9a497b' Feb 20 19:00:47 localhost kernel: Loaded X.509 cert 'Red Hat Enterprise Linux Driver Update Program (key 3): bf57f3e87362bc7229d9f465321773dfd1f77a80' Feb 20 19:00:47 localhost kernel: Loaded X.509 cert 'Red Hat Enterprise Linux kpatch signing key: 4d38fd864ebe18c5f0b72e3852e2014c3a676fc8' Feb 20 19:00:47 localhost kernel: Loaded X.509 cert 'RH-IMA-CA: Red Hat IMA CA: fb31825dd0e073685b264e3038963673f753959a' Feb 20 19:00:47 localhost kernel: Loaded X.509 cert 'Nvidia GPU OOT signing 001: 55e1cef88193e60419f0b0ec379c49f77545acf0' Feb 20 19:00:47 localhost kernel: Demotion targets for Node 0: null Feb 20 19:00:47 localhost kernel: page_owner is disabled Feb 20 19:00:47 localhost kernel: Key type .fscrypt registered Feb 20 19:00:47 localhost kernel: Key type fscrypt-provisioning registered Feb 20 19:00:47 localhost kernel: Key type big_key registered Feb 20 19:00:47 localhost kernel: Key type encrypted registered Feb 20 19:00:47 localhost kernel: ima: No TPM chip found, activating TPM-bypass! Feb 20 19:00:47 localhost kernel: Loading compiled-in module X.509 certificates Feb 20 19:00:47 localhost kernel: Loaded X.509 cert 'The CentOS Project: CentOS Stream kernel signing key: 4fde1469d8033882223ec575c1a1c1b88c9a497b' Feb 20 19:00:47 localhost kernel: ima: Allocated hash algorithm: sha256 Feb 20 19:00:47 localhost kernel: ima: No architecture policies found Feb 20 19:00:47 localhost kernel: evm: Initialising EVM extended attributes: Feb 20 19:00:47 localhost kernel: evm: security.selinux Feb 20 19:00:47 localhost kernel: evm: security.SMACK64 (disabled) Feb 20 19:00:47 localhost kernel: evm: security.SMACK64EXEC (disabled) Feb 20 19:00:47 localhost kernel: evm: security.SMACK64TRANSMUTE (disabled) Feb 20 19:00:47 localhost kernel: evm: security.SMACK64MMAP (disabled) Feb 20 19:00:47 localhost kernel: evm: security.apparmor (disabled) Feb 20 19:00:47 localhost kernel: evm: security.ima Feb 20 19:00:47 localhost kernel: evm: security.capability Feb 20 19:00:47 localhost kernel: evm: HMAC attrs: 0x1 Feb 20 19:00:47 localhost kernel: usb 1-1: new full-speed USB device number 2 using uhci_hcd Feb 20 19:00:47 localhost kernel: Running certificate verification RSA selftest Feb 20 19:00:47 localhost kernel: Loaded X.509 cert 'Certificate verification self-testing key: f58703bb33ce1b73ee02eccdee5b8817518fe3db' Feb 20 19:00:47 localhost kernel: Running certificate verification ECDSA selftest Feb 20 19:00:47 localhost kernel: Loaded X.509 cert 'Certificate verification ECDSA self-testing key: 2900bcea1deb7bc8479a84a23d758efdfdd2b2d3' Feb 20 19:00:47 localhost kernel: clk: Disabling unused clocks Feb 20 19:00:47 localhost kernel: Freeing unused decrypted memory: 2028K Feb 20 19:00:47 localhost kernel: Freeing unused kernel image (initmem) memory: 4204K Feb 20 19:00:47 localhost kernel: Write protecting the kernel read-only data: 30720k Feb 20 19:00:47 localhost kernel: Freeing unused kernel image (rodata/data gap) memory: 388K Feb 20 19:00:47 localhost kernel: usb 1-1: New USB device found, idVendor=0627, idProduct=0001, bcdDevice= 0.00 Feb 20 19:00:47 localhost kernel: usb 1-1: New USB device strings: Mfr=1, Product=3, SerialNumber=10 Feb 20 19:00:47 localhost kernel: usb 1-1: Product: QEMU USB Tablet Feb 20 19:00:47 localhost kernel: usb 1-1: Manufacturer: QEMU Feb 20 19:00:47 localhost kernel: usb 1-1: SerialNumber: 28754-0000:00:01.2-1 Feb 20 19:00:47 localhost kernel: input: QEMU QEMU USB Tablet as /devices/pci0000:00/0000:00:01.2/usb1/1-1/1-1:1.0/0003:0627:0001.0001/input/input5 Feb 20 19:00:47 localhost kernel: hid-generic 0003:0627:0001.0001: input,hidraw0: USB HID v0.01 Mouse [QEMU QEMU USB Tablet] on usb-0000:00:01.2-1/input0 Feb 20 19:00:47 localhost kernel: x86/mm: Checked W+X mappings: passed, no W+X pages found. Feb 20 19:00:47 localhost kernel: Run /init as init process Feb 20 19:00:47 localhost kernel: with arguments: Feb 20 19:00:47 localhost kernel: /init Feb 20 19:00:47 localhost kernel: with environment: Feb 20 19:00:47 localhost kernel: HOME=/ Feb 20 19:00:47 localhost kernel: TERM=linux Feb 20 19:00:47 localhost kernel: BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-681.el9.x86_64 Feb 20 19:00:47 localhost systemd[1]: systemd 252-64.el9 running in system mode (+PAM +AUDIT +SELINUX -APPARMOR +IMA +SMACK +SECCOMP +GCRYPT +GNUTLS +OPENSSL +ACL +BLKID +CURL +ELFUTILS +FIDO2 +IDN2 -IDN -IPTC +KMOD +LIBCRYPTSETUP +LIBFDISK +PCRE2 -PWQUALITY +P11KIT -QRENCODE +TPM2 +BZIP2 +LZ4 +XZ +ZLIB +ZSTD -BPF_FRAMEWORK +XKBCOMMON +UTMP +SYSVINIT default-hierarchy=unified) Feb 20 19:00:47 localhost systemd[1]: Detected virtualization kvm. Feb 20 19:00:47 localhost systemd[1]: Detected architecture x86-64. Feb 20 19:00:47 localhost systemd[1]: Running in initrd. Feb 20 19:00:47 localhost systemd[1]: No hostname configured, using default hostname. Feb 20 19:00:47 localhost systemd[1]: Hostname set to . Feb 20 19:00:47 localhost systemd[1]: Initializing machine ID from VM UUID. Feb 20 19:00:47 localhost systemd[1]: Queued start job for default target Initrd Default Target. Feb 20 19:00:47 localhost systemd[1]: Started Dispatch Password Requests to Console Directory Watch. Feb 20 19:00:47 localhost systemd[1]: Reached target Local Encrypted Volumes. Feb 20 19:00:47 localhost systemd[1]: Reached target Initrd /usr File System. Feb 20 19:00:47 localhost systemd[1]: Reached target Local File Systems. Feb 20 19:00:47 localhost systemd[1]: Reached target Path Units. Feb 20 19:00:47 localhost systemd[1]: Reached target Slice Units. Feb 20 19:00:47 localhost systemd[1]: Reached target Swaps. Feb 20 19:00:47 localhost systemd[1]: Reached target Timer Units. Feb 20 19:00:47 localhost systemd[1]: Listening on D-Bus System Message Bus Socket. Feb 20 19:00:47 localhost systemd[1]: Listening on Journal Socket (/dev/log). Feb 20 19:00:47 localhost systemd[1]: Listening on Journal Socket. Feb 20 19:00:47 localhost systemd[1]: Listening on udev Control Socket. Feb 20 19:00:47 localhost systemd[1]: Listening on udev Kernel Socket. Feb 20 19:00:47 localhost systemd[1]: Reached target Socket Units. Feb 20 19:00:47 localhost systemd[1]: Starting Create List of Static Device Nodes... Feb 20 19:00:47 localhost systemd[1]: Starting Journal Service... Feb 20 19:00:47 localhost systemd[1]: Load Kernel Modules was skipped because no trigger condition checks were met. Feb 20 19:00:47 localhost systemd[1]: Starting Apply Kernel Variables... Feb 20 19:00:47 localhost systemd[1]: Starting Create System Users... Feb 20 19:00:47 localhost systemd[1]: Starting Setup Virtual Console... Feb 20 19:00:47 localhost systemd[1]: Finished Create List of Static Device Nodes. Feb 20 19:00:47 localhost systemd[1]: Finished Apply Kernel Variables. Feb 20 19:00:47 localhost systemd-journald[302]: Journal started Feb 20 19:00:47 localhost systemd-journald[302]: Runtime Journal (/run/log/journal/ffb0361a68c34062b69b735036016c88) is 8.0M, max 153.6M, 145.6M free. Feb 20 19:00:47 localhost systemd[1]: Started Journal Service. Feb 20 19:00:47 localhost systemd-sysusers[307]: Creating group 'users' with GID 100. Feb 20 19:00:47 localhost systemd-sysusers[307]: Creating group 'dbus' with GID 81. Feb 20 19:00:47 localhost systemd-sysusers[307]: Creating user 'dbus' (System Message Bus) with UID 81 and GID 81. Feb 20 19:00:47 localhost systemd[1]: Finished Create System Users. Feb 20 19:00:47 localhost systemd[1]: Starting Create Static Device Nodes in /dev... Feb 20 19:00:47 localhost systemd[1]: Starting Create Volatile Files and Directories... Feb 20 19:00:47 localhost systemd[1]: Finished Create Static Device Nodes in /dev. Feb 20 19:00:47 localhost systemd[1]: Finished Create Volatile Files and Directories. Feb 20 19:00:47 localhost systemd[1]: Finished Setup Virtual Console. Feb 20 19:00:47 localhost systemd[1]: dracut ask for additional cmdline parameters was skipped because no trigger condition checks were met. Feb 20 19:00:47 localhost systemd[1]: Starting dracut cmdline hook... Feb 20 19:00:47 localhost dracut-cmdline[322]: dracut-9 dracut-057-110.git20260130.el9 Feb 20 19:00:47 localhost dracut-cmdline[322]: Using kernel command line parameters: BOOT_IMAGE=(hd0,msdos1)/boot/vmlinuz-5.14.0-681.el9.x86_64 root=UUID=9d578f93-c4e9-4172-8459-ef150e54751c ro console=ttyS0,115200n8 no_timer_check net.ifnames=0 crashkernel=1G-2G:192M,2G-64G:256M,64G-:512M Feb 20 19:00:47 localhost systemd[1]: Finished dracut cmdline hook. Feb 20 19:00:47 localhost systemd[1]: Starting dracut pre-udev hook... Feb 20 19:00:47 localhost kernel: device-mapper: core: CONFIG_IMA_DISABLE_HTABLE is disabled. Duplicate IMA measurements will not be recorded in the IMA log. Feb 20 19:00:47 localhost kernel: device-mapper: uevent: version 1.0.3 Feb 20 19:00:47 localhost kernel: device-mapper: ioctl: 4.50.0-ioctl (2025-04-28) initialised: dm-devel@lists.linux.dev Feb 20 19:00:47 localhost kernel: RPC: Registered named UNIX socket transport module. Feb 20 19:00:47 localhost kernel: RPC: Registered udp transport module. Feb 20 19:00:47 localhost kernel: RPC: Registered tcp transport module. Feb 20 19:00:47 localhost kernel: RPC: Registered tcp-with-tls transport module. Feb 20 19:00:47 localhost kernel: RPC: Registered tcp NFSv4.1 backchannel transport module. Feb 20 19:00:47 localhost rpc.statd[437]: Version 2.5.4 starting Feb 20 19:00:47 localhost rpc.statd[437]: Initializing NSM state Feb 20 19:00:47 localhost rpc.idmapd[442]: Setting log level to 0 Feb 20 19:00:47 localhost systemd[1]: Finished dracut pre-udev hook. Feb 20 19:00:47 localhost systemd[1]: Starting Rule-based Manager for Device Events and Files... Feb 20 19:00:47 localhost systemd-udevd[455]: Using default interface naming scheme 'rhel-9.0'. Feb 20 19:00:47 localhost systemd[1]: Started Rule-based Manager for Device Events and Files. Feb 20 19:00:47 localhost systemd[1]: Starting dracut pre-trigger hook... Feb 20 19:00:47 localhost systemd[1]: Finished dracut pre-trigger hook. Feb 20 19:00:48 localhost systemd[1]: Starting Coldplug All udev Devices... Feb 20 19:00:48 localhost systemd[1]: Created slice Slice /system/modprobe. Feb 20 19:00:48 localhost systemd[1]: Starting Load Kernel Module configfs... Feb 20 19:00:48 localhost systemd[1]: Finished Coldplug All udev Devices. Feb 20 19:00:48 localhost systemd[1]: modprobe@configfs.service: Deactivated successfully. Feb 20 19:00:48 localhost systemd[1]: Finished Load Kernel Module configfs. Feb 20 19:00:48 localhost systemd[1]: nm-initrd.service was skipped because of an unmet condition check (ConditionPathExists=/run/NetworkManager/initrd/neednet). Feb 20 19:00:48 localhost systemd[1]: Reached target Network. Feb 20 19:00:48 localhost systemd[1]: nm-wait-online-initrd.service was skipped because of an unmet condition check (ConditionPathExists=/run/NetworkManager/initrd/neednet). Feb 20 19:00:48 localhost systemd[1]: Starting dracut initqueue hook... Feb 20 19:00:48 localhost systemd[1]: Mounting Kernel Configuration File System... Feb 20 19:00:48 localhost systemd[1]: Mounted Kernel Configuration File System. Feb 20 19:00:48 localhost systemd[1]: Reached target System Initialization. Feb 20 19:00:48 localhost systemd[1]: Reached target Basic System. Feb 20 19:00:48 localhost kernel: virtio_blk virtio2: 8/0/0 default/read/poll queues Feb 20 19:00:48 localhost kernel: virtio_blk virtio2: [vda] 83886080 512-byte logical blocks (42.9 GB/40.0 GiB) Feb 20 19:00:48 localhost kernel: vda: vda1 Feb 20 19:00:48 localhost kernel: libata version 3.00 loaded. Feb 20 19:00:48 localhost kernel: ata_piix 0000:00:01.1: version 2.13 Feb 20 19:00:48 localhost kernel: scsi host0: ata_piix Feb 20 19:00:48 localhost kernel: scsi host1: ata_piix Feb 20 19:00:48 localhost kernel: ata1: PATA max MWDMA2 cmd 0x1f0 ctl 0x3f6 bmdma 0xc140 irq 14 lpm-pol 0 Feb 20 19:00:48 localhost kernel: ata2: PATA max MWDMA2 cmd 0x170 ctl 0x376 bmdma 0xc148 irq 15 lpm-pol 0 Feb 20 19:00:48 localhost systemd[1]: Found device /dev/disk/by-uuid/9d578f93-c4e9-4172-8459-ef150e54751c. Feb 20 19:00:48 localhost kernel: ACPI: bus type drm_connector registered Feb 20 19:00:48 localhost systemd[1]: Reached target Initrd Root Device. Feb 20 19:00:48 localhost kernel: ata1: found unknown device (class 0) Feb 20 19:00:48 localhost kernel: ata1.00: ATAPI: QEMU DVD-ROM, 2.5+, max UDMA/100 Feb 20 19:00:48 localhost kernel: scsi 0:0:0:0: CD-ROM QEMU QEMU DVD-ROM 2.5+ PQ: 0 ANSI: 5 Feb 20 19:00:48 localhost systemd-udevd[479]: Network interface NamePolicy= disabled on kernel command line. Feb 20 19:00:48 localhost kernel: scsi 0:0:0:0: Attached scsi generic sg0 type 5 Feb 20 19:00:48 localhost kernel: sr 0:0:0:0: [sr0] scsi3-mmc drive: 4x/4x cd/rw xa/form2 tray Feb 20 19:00:48 localhost kernel: cdrom: Uniform CD-ROM driver Revision: 3.20 Feb 20 19:00:48 localhost kernel: [drm] pci: virtio-vga detected at 0000:00:02.0 Feb 20 19:00:48 localhost kernel: virtio-pci 0000:00:02.0: vgaarb: deactivate vga console Feb 20 19:00:48 localhost kernel: Console: switching to colour dummy device 80x25 Feb 20 19:00:48 localhost kernel: sr 0:0:0:0: Attached scsi CD-ROM sr0 Feb 20 19:00:48 localhost kernel: [drm] features: -virgl +edid -resource_blob -host_visible Feb 20 19:00:48 localhost kernel: [drm] features: -context_init Feb 20 19:00:48 localhost kernel: [drm] number of scanouts: 1 Feb 20 19:00:48 localhost kernel: [drm] number of cap sets: 0 Feb 20 19:00:48 localhost kernel: [drm] Initialized virtio_gpu 0.1.0 for 0000:00:02.0 on minor 0 Feb 20 19:00:48 localhost kernel: fbcon: virtio_gpudrmfb (fb0) is primary device Feb 20 19:00:48 localhost kernel: Console: switching to colour frame buffer device 128x48 Feb 20 19:00:48 localhost kernel: virtio-pci 0000:00:02.0: [drm] fb0: virtio_gpudrmfb frame buffer device Feb 20 19:00:48 localhost systemd[1]: Finished dracut initqueue hook. Feb 20 19:00:48 localhost systemd[1]: Reached target Preparation for Remote File Systems. Feb 20 19:00:48 localhost systemd[1]: Reached target Remote Encrypted Volumes. Feb 20 19:00:48 localhost systemd[1]: Reached target Remote File Systems. Feb 20 19:00:48 localhost systemd[1]: Starting dracut pre-mount hook... Feb 20 19:00:48 localhost systemd[1]: Finished dracut pre-mount hook. Feb 20 19:00:48 localhost systemd[1]: Starting File System Check on /dev/disk/by-uuid/9d578f93-c4e9-4172-8459-ef150e54751c... Feb 20 19:00:48 localhost systemd-fsck[562]: /usr/sbin/fsck.xfs: XFS file system. Feb 20 19:00:48 localhost systemd[1]: Finished File System Check on /dev/disk/by-uuid/9d578f93-c4e9-4172-8459-ef150e54751c. Feb 20 19:00:48 localhost systemd[1]: Mounting /sysroot... Feb 20 19:00:49 localhost kernel: SGI XFS with ACLs, security attributes, scrub, quota, no debug enabled Feb 20 19:00:49 localhost kernel: XFS (vda1): Mounting V5 Filesystem 9d578f93-c4e9-4172-8459-ef150e54751c Feb 20 19:00:49 localhost kernel: XFS (vda1): Ending clean mount Feb 20 19:00:49 localhost systemd[1]: Mounted /sysroot. Feb 20 19:00:49 localhost systemd[1]: Reached target Initrd Root File System. Feb 20 19:00:49 localhost systemd[1]: Starting Mountpoints Configured in the Real Root... Feb 20 19:00:49 localhost systemd[1]: initrd-parse-etc.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Finished Mountpoints Configured in the Real Root. Feb 20 19:00:49 localhost systemd[1]: Reached target Initrd File Systems. Feb 20 19:00:49 localhost systemd[1]: Reached target Initrd Default Target. Feb 20 19:00:49 localhost systemd[1]: Starting dracut mount hook... Feb 20 19:00:49 localhost systemd[1]: Finished dracut mount hook. Feb 20 19:00:49 localhost systemd[1]: Starting dracut pre-pivot and cleanup hook... Feb 20 19:00:49 localhost rpc.idmapd[442]: exiting on signal 15 Feb 20 19:00:49 localhost systemd[1]: var-lib-nfs-rpc_pipefs.mount: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Finished dracut pre-pivot and cleanup hook. Feb 20 19:00:49 localhost systemd[1]: Starting Cleaning Up and Shutting Down Daemons... Feb 20 19:00:49 localhost systemd[1]: Stopped target Network. Feb 20 19:00:49 localhost systemd[1]: Stopped target Remote Encrypted Volumes. Feb 20 19:00:49 localhost systemd[1]: Stopped target Timer Units. Feb 20 19:00:49 localhost systemd[1]: dbus.socket: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Closed D-Bus System Message Bus Socket. Feb 20 19:00:49 localhost systemd[1]: dracut-pre-pivot.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped dracut pre-pivot and cleanup hook. Feb 20 19:00:49 localhost systemd[1]: Stopped target Initrd Default Target. Feb 20 19:00:49 localhost systemd[1]: Stopped target Basic System. Feb 20 19:00:49 localhost systemd[1]: Stopped target Initrd Root Device. Feb 20 19:00:49 localhost systemd[1]: Stopped target Initrd /usr File System. Feb 20 19:00:49 localhost systemd[1]: Stopped target Path Units. Feb 20 19:00:49 localhost systemd[1]: Stopped target Remote File Systems. Feb 20 19:00:49 localhost systemd[1]: Stopped target Preparation for Remote File Systems. Feb 20 19:00:49 localhost systemd[1]: Stopped target Slice Units. Feb 20 19:00:49 localhost systemd[1]: Stopped target Socket Units. Feb 20 19:00:49 localhost systemd[1]: Stopped target System Initialization. Feb 20 19:00:49 localhost systemd[1]: Stopped target Local File Systems. Feb 20 19:00:49 localhost systemd[1]: Stopped target Swaps. Feb 20 19:00:49 localhost systemd[1]: dracut-mount.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped dracut mount hook. Feb 20 19:00:49 localhost systemd[1]: dracut-pre-mount.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped dracut pre-mount hook. Feb 20 19:00:49 localhost systemd[1]: Stopped target Local Encrypted Volumes. Feb 20 19:00:49 localhost systemd[1]: systemd-ask-password-console.path: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped Dispatch Password Requests to Console Directory Watch. Feb 20 19:00:49 localhost systemd[1]: dracut-initqueue.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped dracut initqueue hook. Feb 20 19:00:49 localhost systemd[1]: systemd-sysctl.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped Apply Kernel Variables. Feb 20 19:00:49 localhost systemd[1]: systemd-tmpfiles-setup.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped Create Volatile Files and Directories. Feb 20 19:00:49 localhost systemd[1]: systemd-udev-trigger.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped Coldplug All udev Devices. Feb 20 19:00:49 localhost systemd[1]: dracut-pre-trigger.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped dracut pre-trigger hook. Feb 20 19:00:49 localhost systemd[1]: Stopping Rule-based Manager for Device Events and Files... Feb 20 19:00:49 localhost systemd[1]: systemd-vconsole-setup.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped Setup Virtual Console. Feb 20 19:00:49 localhost systemd[1]: run-credentials-systemd\x2dtmpfiles\x2dsetup.service.mount: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: run-credentials-systemd\x2dsysctl.service.mount: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: systemd-udevd.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped Rule-based Manager for Device Events and Files. Feb 20 19:00:49 localhost systemd[1]: systemd-udevd.service: Consumed 1.171s CPU time. Feb 20 19:00:49 localhost systemd[1]: systemd-udevd-control.socket: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Closed udev Control Socket. Feb 20 19:00:49 localhost systemd[1]: systemd-udevd-kernel.socket: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Closed udev Kernel Socket. Feb 20 19:00:49 localhost systemd[1]: dracut-pre-udev.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped dracut pre-udev hook. Feb 20 19:00:49 localhost systemd[1]: dracut-cmdline.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped dracut cmdline hook. Feb 20 19:00:49 localhost systemd[1]: Starting Cleanup udev Database... Feb 20 19:00:49 localhost systemd[1]: systemd-tmpfiles-setup-dev.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped Create Static Device Nodes in /dev. Feb 20 19:00:49 localhost systemd[1]: kmod-static-nodes.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped Create List of Static Device Nodes. Feb 20 19:00:49 localhost systemd[1]: systemd-sysusers.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Stopped Create System Users. Feb 20 19:00:49 localhost systemd[1]: run-credentials-systemd\x2dtmpfiles\x2dsetup\x2ddev.service.mount: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: run-credentials-systemd\x2dsysusers.service.mount: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: initrd-cleanup.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Finished Cleaning Up and Shutting Down Daemons. Feb 20 19:00:49 localhost systemd[1]: initrd-udevadm-cleanup-db.service: Deactivated successfully. Feb 20 19:00:49 localhost systemd[1]: Finished Cleanup udev Database. Feb 20 19:00:49 localhost systemd[1]: Reached target Switch Root. Feb 20 19:00:49 localhost systemd[1]: Starting Switch Root... Feb 20 19:00:49 localhost systemd[1]: Switching root. Feb 20 19:00:49 localhost systemd-journald[302]: Journal stopped Feb 20 19:00:50 localhost systemd-journald[302]: Received SIGTERM from PID 1 (systemd). Feb 20 19:00:50 localhost kernel: audit: type=1404 audit(1771632049.804:2): enforcing=1 old_enforcing=0 auid=4294967295 ses=4294967295 enabled=1 old-enabled=1 lsm=selinux res=1 Feb 20 19:00:50 localhost kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:00:50 localhost kernel: SELinux: policy capability open_perms=1 Feb 20 19:00:50 localhost kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:00:50 localhost kernel: SELinux: policy capability always_check_network=0 Feb 20 19:00:50 localhost kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:00:50 localhost kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:00:50 localhost kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:00:50 localhost kernel: audit: type=1403 audit(1771632049.911:3): auid=4294967295 ses=4294967295 lsm=selinux res=1 Feb 20 19:00:50 localhost systemd[1]: Successfully loaded SELinux policy in 110.208ms. Feb 20 19:00:50 localhost systemd[1]: Relabelled /dev, /dev/shm, /run, /sys/fs/cgroup in 23.808ms. Feb 20 19:00:50 localhost systemd[1]: systemd 252-64.el9 running in system mode (+PAM +AUDIT +SELINUX -APPARMOR +IMA +SMACK +SECCOMP +GCRYPT +GNUTLS +OPENSSL +ACL +BLKID +CURL +ELFUTILS +FIDO2 +IDN2 -IDN -IPTC +KMOD +LIBCRYPTSETUP +LIBFDISK +PCRE2 -PWQUALITY +P11KIT -QRENCODE +TPM2 +BZIP2 +LZ4 +XZ +ZLIB +ZSTD -BPF_FRAMEWORK +XKBCOMMON +UTMP +SYSVINIT default-hierarchy=unified) Feb 20 19:00:50 localhost systemd[1]: Detected virtualization kvm. Feb 20 19:00:50 localhost systemd[1]: Detected architecture x86-64. Feb 20 19:00:50 localhost systemd-rc-local-generator[645]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:00:50 localhost systemd[1]: initrd-switch-root.service: Deactivated successfully. Feb 20 19:00:50 localhost systemd[1]: Stopped Switch Root. Feb 20 19:00:50 localhost systemd[1]: systemd-journald.service: Scheduled restart job, restart counter is at 1. Feb 20 19:00:50 localhost systemd[1]: Created slice Slice /system/getty. Feb 20 19:00:50 localhost systemd[1]: Created slice Slice /system/serial-getty. Feb 20 19:00:50 localhost systemd[1]: Created slice Slice /system/sshd-keygen. Feb 20 19:00:50 localhost systemd[1]: Created slice User and Session Slice. Feb 20 19:00:50 localhost systemd[1]: Started Dispatch Password Requests to Console Directory Watch. Feb 20 19:00:50 localhost systemd[1]: Started Forward Password Requests to Wall Directory Watch. Feb 20 19:00:50 localhost systemd[1]: Set up automount Arbitrary Executable File Formats File System Automount Point. Feb 20 19:00:50 localhost systemd[1]: Reached target Local Encrypted Volumes. Feb 20 19:00:50 localhost systemd[1]: Stopped target Switch Root. Feb 20 19:00:50 localhost systemd[1]: Stopped target Initrd File Systems. Feb 20 19:00:50 localhost systemd[1]: Stopped target Initrd Root File System. Feb 20 19:00:50 localhost systemd[1]: Reached target Local Integrity Protected Volumes. Feb 20 19:00:50 localhost systemd[1]: Reached target Path Units. Feb 20 19:00:50 localhost systemd[1]: Reached target rpc_pipefs.target. Feb 20 19:00:50 localhost systemd[1]: Reached target Slice Units. Feb 20 19:00:50 localhost systemd[1]: Reached target Swaps. Feb 20 19:00:50 localhost systemd[1]: Reached target Local Verity Protected Volumes. Feb 20 19:00:50 localhost systemd[1]: Listening on RPCbind Server Activation Socket. Feb 20 19:00:50 localhost systemd[1]: Reached target RPC Port Mapper. Feb 20 19:00:50 localhost systemd[1]: Listening on Process Core Dump Socket. Feb 20 19:00:50 localhost systemd[1]: Listening on initctl Compatibility Named Pipe. Feb 20 19:00:50 localhost systemd[1]: Listening on udev Control Socket. Feb 20 19:00:50 localhost systemd[1]: Listening on udev Kernel Socket. Feb 20 19:00:50 localhost systemd[1]: Mounting Huge Pages File System... Feb 20 19:00:50 localhost systemd[1]: Mounting POSIX Message Queue File System... Feb 20 19:00:50 localhost systemd[1]: Mounting Kernel Debug File System... Feb 20 19:00:50 localhost systemd[1]: Mounting Kernel Trace File System... Feb 20 19:00:50 localhost systemd[1]: Kernel Module supporting RPCSEC_GSS was skipped because of an unmet condition check (ConditionPathExists=/etc/krb5.keytab). Feb 20 19:00:50 localhost systemd[1]: Starting Create List of Static Device Nodes... Feb 20 19:00:50 localhost systemd[1]: Starting Load Kernel Module configfs... Feb 20 19:00:50 localhost systemd[1]: Starting Load Kernel Module drm... Feb 20 19:00:50 localhost systemd[1]: Starting Load Kernel Module efi_pstore... Feb 20 19:00:50 localhost systemd[1]: Starting Load Kernel Module fuse... Feb 20 19:00:50 localhost systemd[1]: Starting Read and set NIS domainname from /etc/sysconfig/network... Feb 20 19:00:50 localhost systemd[1]: systemd-fsck-root.service: Deactivated successfully. Feb 20 19:00:50 localhost systemd[1]: Stopped File System Check on Root Device. Feb 20 19:00:50 localhost systemd[1]: Stopped Journal Service. Feb 20 19:00:50 localhost kernel: fuse: init (API version 7.37) Feb 20 19:00:50 localhost systemd[1]: Starting Journal Service... Feb 20 19:00:50 localhost systemd[1]: Load Kernel Modules was skipped because no trigger condition checks were met. Feb 20 19:00:50 localhost systemd[1]: Starting Generate network units from Kernel command line... Feb 20 19:00:50 localhost systemd[1]: TPM2 PCR Machine ID Measurement was skipped because of an unmet condition check (ConditionPathExists=/sys/firmware/efi/efivars/StubPcrKernelImage-4a67b082-0a4c-41cf-b6c7-440b29bb8c4f). Feb 20 19:00:50 localhost systemd[1]: Starting Remount Root and Kernel File Systems... Feb 20 19:00:50 localhost systemd[1]: Repartition Root Disk was skipped because no trigger condition checks were met. Feb 20 19:00:50 localhost systemd[1]: Starting Apply Kernel Variables... Feb 20 19:00:50 localhost systemd[1]: Starting Coldplug All udev Devices... Feb 20 19:00:50 localhost kernel: xfs filesystem being remounted at / supports timestamps until 2038 (0x7fffffff) Feb 20 19:00:50 localhost systemd[1]: Mounted Huge Pages File System. Feb 20 19:00:50 localhost systemd-journald[693]: Journal started Feb 20 19:00:50 localhost systemd-journald[693]: Runtime Journal (/run/log/journal/621707288f5710e1387f73ed6d90e964) is 8.0M, max 153.6M, 145.6M free. Feb 20 19:00:50 localhost systemd[1]: Queued start job for default target Multi-User System. Feb 20 19:00:50 localhost systemd[1]: systemd-journald.service: Deactivated successfully. Feb 20 19:00:50 localhost systemd[1]: Started Journal Service. Feb 20 19:00:50 localhost systemd[1]: Mounted POSIX Message Queue File System. Feb 20 19:00:50 localhost systemd[1]: Mounted Kernel Debug File System. Feb 20 19:00:50 localhost systemd[1]: Mounted Kernel Trace File System. Feb 20 19:00:50 localhost systemd[1]: Finished Create List of Static Device Nodes. Feb 20 19:00:50 localhost systemd[1]: modprobe@configfs.service: Deactivated successfully. Feb 20 19:00:50 localhost systemd[1]: Finished Load Kernel Module configfs. Feb 20 19:00:50 localhost systemd[1]: modprobe@drm.service: Deactivated successfully. Feb 20 19:00:50 localhost systemd[1]: Finished Load Kernel Module drm. Feb 20 19:00:50 localhost systemd[1]: modprobe@efi_pstore.service: Deactivated successfully. Feb 20 19:00:50 localhost systemd[1]: Finished Load Kernel Module efi_pstore. Feb 20 19:00:50 localhost systemd[1]: modprobe@fuse.service: Deactivated successfully. Feb 20 19:00:50 localhost systemd[1]: Finished Load Kernel Module fuse. Feb 20 19:00:50 localhost systemd[1]: Finished Read and set NIS domainname from /etc/sysconfig/network. Feb 20 19:00:50 localhost systemd[1]: Finished Generate network units from Kernel command line. Feb 20 19:00:50 localhost systemd[1]: Finished Remount Root and Kernel File Systems. Feb 20 19:00:50 localhost systemd[1]: Finished Apply Kernel Variables. Feb 20 19:00:50 localhost systemd[1]: Mounting FUSE Control File System... Feb 20 19:00:50 localhost systemd[1]: First Boot Wizard was skipped because of an unmet condition check (ConditionFirstBoot=yes). Feb 20 19:00:50 localhost systemd[1]: Starting Rebuild Hardware Database... Feb 20 19:00:50 localhost systemd[1]: Starting Flush Journal to Persistent Storage... Feb 20 19:00:50 localhost systemd[1]: Platform Persistent Storage Archival was skipped because of an unmet condition check (ConditionDirectoryNotEmpty=/sys/fs/pstore). Feb 20 19:00:50 localhost systemd[1]: Starting Load/Save OS Random Seed... Feb 20 19:00:50 localhost systemd[1]: Starting Create System Users... Feb 20 19:00:50 localhost systemd[1]: Mounted FUSE Control File System. Feb 20 19:00:50 localhost systemd-journald[693]: Runtime Journal (/run/log/journal/621707288f5710e1387f73ed6d90e964) is 8.0M, max 153.6M, 145.6M free. Feb 20 19:00:50 localhost systemd-journald[693]: Received client request to flush runtime journal. Feb 20 19:00:50 localhost systemd[1]: Finished Flush Journal to Persistent Storage. Feb 20 19:00:50 localhost systemd[1]: Finished Coldplug All udev Devices. Feb 20 19:00:50 localhost systemd[1]: Finished Load/Save OS Random Seed. Feb 20 19:00:50 localhost systemd[1]: First Boot Complete was skipped because of an unmet condition check (ConditionFirstBoot=yes). Feb 20 19:00:50 localhost systemd[1]: Finished Create System Users. Feb 20 19:00:50 localhost systemd[1]: Starting Create Static Device Nodes in /dev... Feb 20 19:00:50 localhost systemd[1]: Finished Create Static Device Nodes in /dev. Feb 20 19:00:50 localhost systemd[1]: Reached target Preparation for Local File Systems. Feb 20 19:00:50 localhost systemd[1]: Reached target Local File Systems. Feb 20 19:00:50 localhost systemd[1]: Starting Rebuild Dynamic Linker Cache... Feb 20 19:00:50 localhost systemd[1]: Mark the need to relabel after reboot was skipped because of an unmet condition check (ConditionSecurity=!selinux). Feb 20 19:00:50 localhost systemd[1]: Set Up Additional Binary Formats was skipped because no trigger condition checks were met. Feb 20 19:00:50 localhost systemd[1]: Update Boot Loader Random Seed was skipped because no trigger condition checks were met. Feb 20 19:00:50 localhost systemd[1]: Starting Automatic Boot Loader Update... Feb 20 19:00:50 localhost systemd[1]: Commit a transient machine-id on disk was skipped because of an unmet condition check (ConditionPathIsMountPoint=/etc/machine-id). Feb 20 19:00:50 localhost systemd[1]: Starting Create Volatile Files and Directories... Feb 20 19:00:50 localhost bootctl[709]: Couldn't find EFI system partition, skipping. Feb 20 19:00:50 localhost systemd[1]: Finished Automatic Boot Loader Update. Feb 20 19:00:51 localhost systemd[1]: Finished Create Volatile Files and Directories. Feb 20 19:00:51 localhost systemd[1]: Starting Security Auditing Service... Feb 20 19:00:51 localhost systemd[1]: Starting RPC Bind... Feb 20 19:00:51 localhost systemd[1]: Starting Rebuild Journal Catalog... Feb 20 19:00:51 localhost auditd[715]: audit dispatcher initialized with q_depth=2000 and 1 active plugins Feb 20 19:00:51 localhost auditd[715]: Init complete, auditd 3.1.5 listening for events (startup state enable) Feb 20 19:00:51 localhost systemd[1]: Started RPC Bind. Feb 20 19:00:51 localhost systemd[1]: Finished Rebuild Journal Catalog. Feb 20 19:00:51 localhost augenrules[720]: /sbin/augenrules: No change Feb 20 19:00:51 localhost augenrules[736]: No rules Feb 20 19:00:51 localhost augenrules[736]: enabled 1 Feb 20 19:00:51 localhost augenrules[736]: failure 1 Feb 20 19:00:51 localhost augenrules[736]: pid 715 Feb 20 19:00:51 localhost augenrules[736]: rate_limit 0 Feb 20 19:00:51 localhost augenrules[736]: backlog_limit 8192 Feb 20 19:00:51 localhost augenrules[736]: lost 0 Feb 20 19:00:51 localhost augenrules[736]: backlog 3 Feb 20 19:00:51 localhost augenrules[736]: backlog_wait_time 60000 Feb 20 19:00:51 localhost augenrules[736]: backlog_wait_time_actual 0 Feb 20 19:00:51 localhost augenrules[736]: enabled 1 Feb 20 19:00:51 localhost augenrules[736]: failure 1 Feb 20 19:00:51 localhost augenrules[736]: pid 715 Feb 20 19:00:51 localhost augenrules[736]: rate_limit 0 Feb 20 19:00:51 localhost augenrules[736]: backlog_limit 8192 Feb 20 19:00:51 localhost augenrules[736]: lost 0 Feb 20 19:00:51 localhost augenrules[736]: backlog 2 Feb 20 19:00:51 localhost augenrules[736]: backlog_wait_time 60000 Feb 20 19:00:51 localhost augenrules[736]: backlog_wait_time_actual 0 Feb 20 19:00:51 localhost augenrules[736]: enabled 1 Feb 20 19:00:51 localhost augenrules[736]: failure 1 Feb 20 19:00:51 localhost augenrules[736]: pid 715 Feb 20 19:00:51 localhost augenrules[736]: rate_limit 0 Feb 20 19:00:51 localhost augenrules[736]: backlog_limit 8192 Feb 20 19:00:51 localhost augenrules[736]: lost 0 Feb 20 19:00:51 localhost augenrules[736]: backlog 0 Feb 20 19:00:51 localhost augenrules[736]: backlog_wait_time 60000 Feb 20 19:00:51 localhost augenrules[736]: backlog_wait_time_actual 0 Feb 20 19:00:51 localhost systemd[1]: Started Security Auditing Service. Feb 20 19:00:51 localhost systemd[1]: Starting Record System Boot/Shutdown in UTMP... Feb 20 19:00:51 localhost systemd[1]: Finished Record System Boot/Shutdown in UTMP. Feb 20 19:00:51 localhost systemd[1]: Finished Rebuild Hardware Database. Feb 20 19:00:51 localhost systemd[1]: Starting Rule-based Manager for Device Events and Files... Feb 20 19:00:51 localhost systemd-udevd[745]: Using default interface naming scheme 'rhel-9.0'. Feb 20 19:00:51 localhost systemd[1]: Started Rule-based Manager for Device Events and Files. Feb 20 19:00:51 localhost systemd[1]: Starting Load Kernel Module configfs... Feb 20 19:00:51 localhost systemd[1]: modprobe@configfs.service: Deactivated successfully. Feb 20 19:00:51 localhost systemd[1]: Finished Load Kernel Module configfs. Feb 20 19:00:51 localhost systemd[1]: Condition check resulted in /dev/ttyS0 being skipped. Feb 20 19:00:51 localhost systemd-udevd[772]: Network interface NamePolicy= disabled on kernel command line. Feb 20 19:00:51 localhost kernel: input: PC Speaker as /devices/platform/pcspkr/input/input6 Feb 20 19:00:51 localhost kernel: piix4_smbus 0000:00:01.3: SMBus Host Controller at 0x700, revision 0 Feb 20 19:00:51 localhost kernel: i2c i2c-0: 1/1 memory slots populated (from DMI) Feb 20 19:00:51 localhost kernel: i2c i2c-0: Memory type 0x07 not supported yet, not instantiating SPD Feb 20 19:00:51 localhost kernel: kvm_amd: TSC scaling supported Feb 20 19:00:51 localhost kernel: kvm_amd: Nested Virtualization enabled Feb 20 19:00:51 localhost kernel: kvm_amd: Nested Paging enabled Feb 20 19:00:51 localhost kernel: kvm_amd: LBR virtualization supported Feb 20 19:00:52 localhost systemd[1]: Finished Rebuild Dynamic Linker Cache. Feb 20 19:00:52 localhost systemd[1]: Starting Update is Completed... Feb 20 19:00:52 localhost systemd[1]: Finished Update is Completed. Feb 20 19:00:52 localhost systemd[1]: Reached target System Initialization. Feb 20 19:00:52 localhost systemd[1]: Started dnf makecache --timer. Feb 20 19:00:52 localhost systemd[1]: Started Daily rotation of log files. Feb 20 19:00:52 localhost systemd[1]: Started Daily Cleanup of Temporary Directories. Feb 20 19:00:52 localhost systemd[1]: Reached target Timer Units. Feb 20 19:00:52 localhost systemd[1]: Listening on D-Bus System Message Bus Socket. Feb 20 19:00:52 localhost systemd[1]: Listening on SSSD Kerberos Cache Manager responder socket. Feb 20 19:00:52 localhost systemd[1]: Reached target Socket Units. Feb 20 19:00:52 localhost systemd[1]: Starting D-Bus System Message Bus... Feb 20 19:00:52 localhost systemd[1]: TPM2 PCR Barrier (Initialization) was skipped because of an unmet condition check (ConditionPathExists=/sys/firmware/efi/efivars/StubPcrKernelImage-4a67b082-0a4c-41cf-b6c7-440b29bb8c4f). Feb 20 19:00:52 localhost systemd[1]: Started D-Bus System Message Bus. Feb 20 19:00:52 localhost systemd[1]: Reached target Basic System. Feb 20 19:00:52 localhost dbus-broker-lau[822]: Ready Feb 20 19:00:52 localhost systemd[1]: Starting NTP client/server... Feb 20 19:00:52 localhost systemd[1]: Starting Cloud-init: Local Stage (pre-network)... Feb 20 19:00:52 localhost systemd[1]: Starting Restore /run/initramfs on shutdown... Feb 20 19:00:52 localhost systemd[1]: Starting IPv4 firewall with iptables... Feb 20 19:00:52 localhost systemd[1]: Started irqbalance daemon. Feb 20 19:00:52 localhost systemd[1]: Load CPU microcode update was skipped because of an unmet condition check (ConditionPathExists=/sys/devices/system/cpu/microcode/reload). Feb 20 19:00:52 localhost systemd[1]: OpenSSH ecdsa Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Feb 20 19:00:52 localhost systemd[1]: OpenSSH ed25519 Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Feb 20 19:00:52 localhost systemd[1]: OpenSSH rsa Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Feb 20 19:00:52 localhost systemd[1]: Reached target sshd-keygen.target. Feb 20 19:00:52 localhost systemd[1]: System Security Services Daemon was skipped because no trigger condition checks were met. Feb 20 19:00:52 localhost systemd[1]: Reached target User and Group Name Lookups. Feb 20 19:00:52 localhost systemd[1]: Starting User Login Management... Feb 20 19:00:52 localhost systemd[1]: Finished Restore /run/initramfs on shutdown. Feb 20 19:00:52 localhost chronyd[840]: chronyd version 4.8 starting (+CMDMON +REFCLOCK +RTC +PRIVDROP +SCFILTER +SIGND +NTS +SECHASH +IPV6 +DEBUG) Feb 20 19:00:52 localhost chronyd[840]: Loaded 0 symmetric keys Feb 20 19:00:52 localhost chronyd[840]: Using right/UTC timezone to obtain leap second data Feb 20 19:00:52 localhost chronyd[840]: Loaded seccomp filter (level 2) Feb 20 19:00:52 localhost systemd[1]: Started NTP client/server. Feb 20 19:00:52 localhost systemd-logind[833]: New seat seat0. Feb 20 19:00:52 localhost systemd-logind[833]: Watching system buttons on /dev/input/event0 (Power Button) Feb 20 19:00:52 localhost systemd-logind[833]: Watching system buttons on /dev/input/event1 (AT Translated Set 2 keyboard) Feb 20 19:00:52 localhost systemd[1]: Started User Login Management. Feb 20 19:00:52 localhost kernel: Warning: Deprecated Driver is detected: nft_compat will not be maintained in a future major release and may be disabled Feb 20 19:00:52 localhost kernel: Warning: Deprecated Driver is detected: nft_compat_module_init will not be maintained in a future major release and may be disabled Feb 20 19:00:52 localhost iptables.init[827]: iptables: Applying firewall rules: [ OK ] Feb 20 19:00:52 localhost systemd[1]: Finished IPv4 firewall with iptables. Feb 20 19:00:54 localhost cloud-init[851]: Cloud-init v. 24.4-8.el9 running 'init-local' at Sat, 21 Feb 2026 00:00:54 +0000. Up 9.24 seconds. Feb 20 19:00:54 localhost kernel: ISO 9660 Extensions: Microsoft Joliet Level 3 Feb 20 19:00:54 localhost kernel: ISO 9660 Extensions: RRIP_1991A Feb 20 19:00:54 localhost systemd[1]: run-cloud\x2dinit-tmp-tmpwgzfm4w1.mount: Deactivated successfully. Feb 20 19:00:55 localhost systemd[1]: Starting Hostname Service... Feb 20 19:00:55 localhost systemd[1]: Started Hostname Service. Feb 20 19:00:55 np0005625471.novalocal systemd-hostnamed[867]: Hostname set to (static) Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Finished Cloud-init: Local Stage (pre-network). Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Reached target Preparation for Network. Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Starting Network Manager... Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.4565] NetworkManager (version 1.54.3-2.el9) is starting... (boot:56ed2ff6-8d28-4be8-8a5d-3c83c9d81ad5) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.4570] Read config: /etc/NetworkManager/NetworkManager.conf, /run/NetworkManager/conf.d/15-carrier-timeout.conf Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.4929] manager[0x555ded519000]: monitoring kernel firmware directory '/lib/firmware'. Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.4983] hostname: hostname: using hostnamed Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.4984] hostname: static hostname changed from (none) to "np0005625471.novalocal" Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.4990] dns-mgr: init: dns=default,systemd-resolved rc-manager=symlink (auto) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5265] manager[0x555ded519000]: rfkill: Wi-Fi hardware radio set enabled Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5266] manager[0x555ded519000]: rfkill: WWAN hardware radio set enabled Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Listening on Load/Save RF Kill Switch Status /dev/rfkill Watch. Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5442] Loaded device plugin: NMTeamFactory (/usr/lib64/NetworkManager/1.54.3-2.el9/libnm-device-plugin-team.so) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5443] manager: rfkill: Wi-Fi enabled by radio killswitch; enabled by state file Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5444] manager: rfkill: WWAN enabled by radio killswitch; enabled by state file Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5445] manager: Networking is enabled by state file Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5448] settings: Loaded settings plugin: keyfile (internal) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5562] settings: Loaded settings plugin: ifcfg-rh ("/usr/lib64/NetworkManager/1.54.3-2.el9/libnm-settings-plugin-ifcfg-rh.so") Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Starting Network Manager Script Dispatcher Service... Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5629] Warning: the ifcfg-rh plugin is deprecated, please migrate connections to the keyfile format using "nmcli connection migrate" Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5735] dhcp: init: Using DHCP client 'internal' Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5770] manager: (lo): new Loopback device (/org/freedesktop/NetworkManager/Devices/1) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5793] device (lo): state change: unmanaged -> unavailable (reason 'connection-assumed', managed-type: 'external') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5812] device (lo): state change: unavailable -> disconnected (reason 'connection-assumed', managed-type: 'external') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5829] device (lo): Activation: starting connection 'lo' (26cb2eea-9a47-4677-be91-02d83b3eee98) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5841] manager: (eth0): new Ethernet device (/org/freedesktop/NetworkManager/Devices/2) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5847] device (eth0): state change: unmanaged -> unavailable (reason 'managed', managed-type: 'external') Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Started Network Manager Script Dispatcher Service. Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Started Network Manager. Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5899] bus-manager: acquired D-Bus service "org.freedesktop.NetworkManager" Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5905] device (lo): state change: disconnected -> prepare (reason 'none', managed-type: 'external') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5909] device (lo): state change: prepare -> config (reason 'none', managed-type: 'external') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5912] device (lo): state change: config -> ip-config (reason 'none', managed-type: 'external') Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Reached target Network. Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5916] device (eth0): carrier: link connected Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5921] device (lo): state change: ip-config -> ip-check (reason 'none', managed-type: 'external') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5930] device (eth0): state change: unavailable -> disconnected (reason 'carrier-changed', managed-type: 'full') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5939] policy: auto-activating connection 'System eth0' (5fb06bd0-0bb0-7ffb-45f1-d6edd65f3e03) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5948] device (eth0): Activation: starting connection 'System eth0' (5fb06bd0-0bb0-7ffb-45f1-d6edd65f3e03) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5949] device (eth0): state change: disconnected -> prepare (reason 'none', managed-type: 'full') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5953] manager: NetworkManager state is now CONNECTING Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5956] device (eth0): state change: prepare -> config (reason 'none', managed-type: 'full') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5966] device (eth0): state change: config -> ip-config (reason 'none', managed-type: 'full') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5970] dhcp4 (eth0): activation: beginning transaction (timeout in 45 seconds) Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5988] device (lo): state change: ip-check -> secondaries (reason 'none', managed-type: 'external') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5991] device (lo): state change: secondaries -> activated (reason 'none', managed-type: 'external') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.5999] device (lo): Activation: successful, device activated. Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.6020] dhcp4 (eth0): state changed new lease, address=38.102.83.198 Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.6031] policy: set 'System eth0' (eth0) as default for IPv4 routing and DNS Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.6056] device (eth0): state change: ip-config -> ip-check (reason 'none', managed-type: 'full') Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Starting Network Manager Wait Online... Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.6081] device (eth0): state change: ip-check -> secondaries (reason 'none', managed-type: 'full') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.6084] device (eth0): state change: secondaries -> activated (reason 'none', managed-type: 'full') Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.6088] manager: NetworkManager state is now CONNECTED_SITE Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.6092] device (eth0): Activation: successful, device activated. Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.6099] manager: NetworkManager state is now CONNECTED_GLOBAL Feb 20 19:00:55 np0005625471.novalocal NetworkManager[871]: [1771632055.6104] manager: startup complete Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Starting GSSAPI Proxy Daemon... Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Started GSSAPI Proxy Daemon. Feb 20 19:00:55 np0005625471.novalocal systemd[1]: RPC security service for NFS client and server was skipped because of an unmet condition check (ConditionPathExists=/etc/krb5.keytab). Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Reached target NFS client services. Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Reached target Preparation for Remote File Systems. Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Reached target Remote File Systems. Feb 20 19:00:55 np0005625471.novalocal systemd[1]: TPM2 PCR Barrier (User) was skipped because of an unmet condition check (ConditionPathExists=/sys/firmware/efi/efivars/StubPcrKernelImage-4a67b082-0a4c-41cf-b6c7-440b29bb8c4f). Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Finished Network Manager Wait Online. Feb 20 19:00:55 np0005625471.novalocal systemd[1]: Starting Cloud-init: Network Stage... Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: Cloud-init v. 24.4-8.el9 running 'init' at Sat, 21 Feb 2026 00:00:55 +0000. Up 10.66 seconds. Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +++++++++++++++++++++++++++++++++++++++Net device info+++++++++++++++++++++++++++++++++++++++ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +--------+------+------------------------------+---------------+--------+-------------------+ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | Device | Up | Address | Mask | Scope | Hw-Address | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +--------+------+------------------------------+---------------+--------+-------------------+ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | eth0 | True | 38.102.83.198 | 255.255.255.0 | global | fa:16:3e:24:15:74 | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | eth0 | True | fe80::f816:3eff:fe24:1574/64 | . | link | fa:16:3e:24:15:74 | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | lo | True | 127.0.0.1 | 255.0.0.0 | host | . | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | lo | True | ::1/128 | . | host | . | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +--------+------+------------------------------+---------------+--------+-------------------+ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +++++++++++++++++++++++++++++++++Route IPv4 info+++++++++++++++++++++++++++++++++ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +-------+-----------------+---------------+-----------------+-----------+-------+ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | Route | Destination | Gateway | Genmask | Interface | Flags | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +-------+-----------------+---------------+-----------------+-----------+-------+ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | 0 | 0.0.0.0 | 38.102.83.1 | 0.0.0.0 | eth0 | UG | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | 1 | 38.102.83.0 | 0.0.0.0 | 255.255.255.0 | eth0 | U | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | 2 | 169.254.169.254 | 38.102.83.126 | 255.255.255.255 | eth0 | UGH | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +-------+-----------------+---------------+-----------------+-----------+-------+ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +++++++++++++++++++Route IPv6 info+++++++++++++++++++ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +-------+-------------+---------+-----------+-------+ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | Route | Destination | Gateway | Interface | Flags | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: +-------+-------------+---------+-----------+-------+ Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | 1 | fe80::/64 | :: | eth0 | U | Feb 20 19:00:55 np0005625471.novalocal cloud-init[935]: ci-info: | 3 | multicast | :: | eth0 | U | Feb 20 19:00:56 np0005625471.novalocal cloud-init[935]: ci-info: +-------+-------------+---------+-----------+-------+ Feb 20 19:00:57 np0005625471.novalocal useradd[1001]: new group: name=cloud-user, GID=1001 Feb 20 19:00:57 np0005625471.novalocal useradd[1001]: new user: name=cloud-user, UID=1001, GID=1001, home=/home/cloud-user, shell=/bin/bash, from=none Feb 20 19:00:57 np0005625471.novalocal useradd[1001]: add 'cloud-user' to group 'adm' Feb 20 19:00:57 np0005625471.novalocal useradd[1001]: add 'cloud-user' to group 'systemd-journal' Feb 20 19:00:57 np0005625471.novalocal useradd[1001]: add 'cloud-user' to shadow group 'adm' Feb 20 19:00:57 np0005625471.novalocal useradd[1001]: add 'cloud-user' to shadow group 'systemd-journal' Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: Generating public/private rsa key pair. Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: Your identification has been saved in /etc/ssh/ssh_host_rsa_key Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: Your public key has been saved in /etc/ssh/ssh_host_rsa_key.pub Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: The key fingerprint is: Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: SHA256:pnxZzFwMwVbAn/3tX9kywSybYwbaPBBnQF+w0VfoXbk root@np0005625471.novalocal Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: The key's randomart image is: Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: +---[RSA 3072]----+ Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | .oo**o oo| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | o+*. o..| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | ..=.o= .o| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | B .oooE.| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | S * . +..| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | . o B . + .=| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | o + + * ooo| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | . + . oo| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | o| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: +----[SHA256]-----+ Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: Generating public/private ecdsa key pair. Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: Your identification has been saved in /etc/ssh/ssh_host_ecdsa_key Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: Your public key has been saved in /etc/ssh/ssh_host_ecdsa_key.pub Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: The key fingerprint is: Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: SHA256:P/xyq5W5OYG7VyUcbZ4GUE7U4gxoYGf1LQ6NdZ1Bjbs root@np0005625471.novalocal Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: The key's randomart image is: Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: +---[ECDSA 256]---+ Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | o.ooo+=o*=| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | . oo .Bo=o=| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | . o+*o*.| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | oo=oo| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | S . ..+ | Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | o. .oE | Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | +.+o | Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | o++o | Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | o*=o | Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: +----[SHA256]-----+ Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: Generating public/private ed25519 key pair. Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: Your identification has been saved in /etc/ssh/ssh_host_ed25519_key Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: Your public key has been saved in /etc/ssh/ssh_host_ed25519_key.pub Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: The key fingerprint is: Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: SHA256:XUzXEwe/XYGOcoOrMydae7eu3WbAsRmb37nCsMSsbI4 root@np0005625471.novalocal Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: The key's randomart image is: Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: +--[ED25519 256]--+ Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | . +=o| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | o o o+| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | . = +| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | + B . +| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | S O O ..| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | . % | Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | .o o * . .| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | .=o*.o.* o | Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: | ..EOo+++....| Feb 20 19:00:58 np0005625471.novalocal cloud-init[935]: +----[SHA256]-----+ Feb 20 19:00:58 np0005625471.novalocal systemd[1]: Finished Cloud-init: Network Stage. Feb 20 19:00:58 np0005625471.novalocal systemd[1]: Reached target Cloud-config availability. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Reached target Network is Online. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Starting Cloud-init: Config Stage... Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Starting Crash recovery kernel arming... Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Starting Notify NFS peers of a restart... Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Starting System Logging Service... Feb 20 19:00:59 np0005625471.novalocal sm-notify[1017]: Version 2.5.4 starting Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Starting OpenSSH server daemon... Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Starting Permit User Sessions... Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Started Notify NFS peers of a restart. Feb 20 19:00:59 np0005625471.novalocal sshd[1019]: Server listening on 0.0.0.0 port 22. Feb 20 19:00:59 np0005625471.novalocal sshd[1019]: Server listening on :: port 22. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Started OpenSSH server daemon. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Finished Permit User Sessions. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Started Command Scheduler. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Started Getty on tty1. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Started Serial Getty on ttyS0. Feb 20 19:00:59 np0005625471.novalocal crond[1022]: (CRON) STARTUP (1.5.7) Feb 20 19:00:59 np0005625471.novalocal crond[1022]: (CRON) INFO (Syslog will be used instead of sendmail.) Feb 20 19:00:59 np0005625471.novalocal crond[1022]: (CRON) INFO (RANDOM_DELAY will be scaled with factor 64% if used.) Feb 20 19:00:59 np0005625471.novalocal crond[1022]: (CRON) INFO (running with inotify support) Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Reached target Login Prompts. Feb 20 19:00:59 np0005625471.novalocal rsyslogd[1018]: [origin software="rsyslogd" swVersion="8.2510.0-2.el9" x-pid="1018" x-info="https://www.rsyslog.com"] start Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Started System Logging Service. Feb 20 19:00:59 np0005625471.novalocal rsyslogd[1018]: imjournal: No statefile exists, /var/lib/rsyslog/imjournal.state will be created (ignore if this is first run): No such file or directory [v8.2510.0-2.el9 try https://www.rsyslog.com/e/2040 ] Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Reached target Multi-User System. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Starting Record Runlevel Change in UTMP... Feb 20 19:00:59 np0005625471.novalocal systemd[1]: systemd-update-utmp-runlevel.service: Deactivated successfully. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Finished Record Runlevel Change in UTMP. Feb 20 19:00:59 np0005625471.novalocal sshd-session[1035]: Connection reset by 38.102.83.114 port 41438 [preauth] Feb 20 19:00:59 np0005625471.novalocal sshd-session[1089]: Unable to negotiate with 38.102.83.114 port 49806: no matching host key type found. Their offer: ssh-ed25519,ssh-ed25519-cert-v01@openssh.com [preauth] Feb 20 19:00:59 np0005625471.novalocal rsyslogd[1018]: imjournal: journal files changed, reloading... [v8.2510.0-2.el9 try https://www.rsyslog.com/e/0 ] Feb 20 19:00:59 np0005625471.novalocal sshd-session[1102]: Connection reset by 38.102.83.114 port 49812 [preauth] Feb 20 19:00:59 np0005625471.novalocal cloud-init[1117]: Cloud-init v. 24.4-8.el9 running 'modules:config' at Sat, 21 Feb 2026 00:00:59 +0000. Up 13.98 seconds. Feb 20 19:00:59 np0005625471.novalocal sshd-session[1116]: Unable to negotiate with 38.102.83.114 port 49828: no matching host key type found. Their offer: ecdsa-sha2-nistp384,ecdsa-sha2-nistp384-cert-v01@openssh.com [preauth] Feb 20 19:00:59 np0005625471.novalocal sshd-session[1125]: Unable to negotiate with 38.102.83.114 port 49834: no matching host key type found. Their offer: ecdsa-sha2-nistp521,ecdsa-sha2-nistp521-cert-v01@openssh.com [preauth] Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Finished Cloud-init: Config Stage. Feb 20 19:00:59 np0005625471.novalocal sshd-session[1153]: Connection reset by 38.102.83.114 port 49852 [preauth] Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Starting Cloud-init: Final Stage... Feb 20 19:00:59 np0005625471.novalocal sshd-session[1161]: Unable to negotiate with 38.102.83.114 port 49868: no matching host key type found. Their offer: ssh-rsa,ssh-rsa-cert-v01@openssh.com [preauth] Feb 20 19:00:59 np0005625471.novalocal sshd-session[1163]: Unable to negotiate with 38.102.83.114 port 49878: no matching host key type found. Their offer: ssh-dss,ssh-dss-cert-v01@openssh.com [preauth] Feb 20 19:00:59 np0005625471.novalocal sshd-session[1129]: Connection closed by 38.102.83.114 port 49848 [preauth] Feb 20 19:00:59 np0005625471.novalocal kdumpctl[1027]: kdump: No kdump initial ramdisk found. Feb 20 19:00:59 np0005625471.novalocal kdumpctl[1027]: kdump: Rebuilding /boot/initramfs-5.14.0-681.el9.x86_64kdump.img Feb 20 19:00:59 np0005625471.novalocal cloud-init[1283]: Cloud-init v. 24.4-8.el9 running 'modules:final' at Sat, 21 Feb 2026 00:00:59 +0000. Up 14.33 seconds. Feb 20 19:00:59 np0005625471.novalocal cloud-init[1335]: ############################################################# Feb 20 19:00:59 np0005625471.novalocal cloud-init[1341]: -----BEGIN SSH HOST KEY FINGERPRINTS----- Feb 20 19:00:59 np0005625471.novalocal cloud-init[1343]: 256 SHA256:P/xyq5W5OYG7VyUcbZ4GUE7U4gxoYGf1LQ6NdZ1Bjbs root@np0005625471.novalocal (ECDSA) Feb 20 19:00:59 np0005625471.novalocal cloud-init[1345]: 256 SHA256:XUzXEwe/XYGOcoOrMydae7eu3WbAsRmb37nCsMSsbI4 root@np0005625471.novalocal (ED25519) Feb 20 19:00:59 np0005625471.novalocal cloud-init[1352]: 3072 SHA256:pnxZzFwMwVbAn/3tX9kywSybYwbaPBBnQF+w0VfoXbk root@np0005625471.novalocal (RSA) Feb 20 19:00:59 np0005625471.novalocal cloud-init[1353]: -----END SSH HOST KEY FINGERPRINTS----- Feb 20 19:00:59 np0005625471.novalocal cloud-init[1354]: ############################################################# Feb 20 19:00:59 np0005625471.novalocal cloud-init[1283]: Cloud-init v. 24.4-8.el9 finished at Sat, 21 Feb 2026 00:00:59 +0000. Datasource DataSourceConfigDrive [net,ver=2][source=/dev/sr0]. Up 14.53 seconds Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Finished Cloud-init: Final Stage. Feb 20 19:00:59 np0005625471.novalocal systemd[1]: Reached target Cloud-init target. Feb 20 19:01:00 np0005625471.novalocal dracut[1541]: dracut-057-110.git20260130.el9 Feb 20 19:01:00 np0005625471.novalocal dracut[1543]: Executing: /usr/bin/dracut --quiet --hostonly --hostonly-cmdline --hostonly-i18n --hostonly-mode strict --hostonly-nics --mount "/dev/disk/by-uuid/9d578f93-c4e9-4172-8459-ef150e54751c /sysroot xfs rw,relatime,seclabel,attr2,inode64,logbufs=8,logbsize=32k,noquota" --squash-compressor zstd --no-hostonly-default-device --add-confdir /lib/kdump/dracut.conf.d -f /boot/initramfs-5.14.0-681.el9.x86_64kdump.img 5.14.0-681.el9.x86_64 Feb 20 19:01:00 np0005625471.novalocal chronyd[840]: Selected source 66.70.172.17 (2.centos.pool.ntp.org) Feb 20 19:01:00 np0005625471.novalocal chronyd[840]: System clock wrong by 1.118188 seconds Feb 20 19:01:01 np0005625471.novalocal chronyd[840]: System clock was stepped by 1.118188 seconds Feb 20 19:01:01 np0005625471.novalocal chronyd[840]: System clock TAI offset set to 37 seconds Feb 20 19:01:02 np0005625471.novalocal CROND[1661]: (root) CMD (run-parts /etc/cron.hourly) Feb 20 19:01:02 np0005625471.novalocal run-parts[1667]: (/etc/cron.hourly) starting 0anacron Feb 20 19:01:02 np0005625471.novalocal anacron[1682]: Anacron started on 2026-02-20 Feb 20 19:01:02 np0005625471.novalocal anacron[1682]: Will run job `cron.daily' in 31 min. Feb 20 19:01:02 np0005625471.novalocal anacron[1682]: Will run job `cron.weekly' in 51 min. Feb 20 19:01:02 np0005625471.novalocal anacron[1682]: Will run job `cron.monthly' in 71 min. Feb 20 19:01:02 np0005625471.novalocal anacron[1682]: Jobs will be executed sequentially Feb 20 19:01:02 np0005625471.novalocal run-parts[1686]: (/etc/cron.hourly) finished 0anacron Feb 20 19:01:02 np0005625471.novalocal CROND[1660]: (root) CMDEND (run-parts /etc/cron.hourly) Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'systemd-networkd' will not be installed, because command 'networkctl' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'systemd-networkd' will not be installed, because command '/usr/lib/systemd/systemd-networkd' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'systemd-networkd' will not be installed, because command '/usr/lib/systemd/systemd-networkd-wait-online' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'systemd-resolved' will not be installed, because command 'resolvectl' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'systemd-resolved' will not be installed, because command '/usr/lib/systemd/systemd-resolved' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'systemd-timesyncd' will not be installed, because command '/usr/lib/systemd/systemd-timesyncd' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'systemd-timesyncd' will not be installed, because command '/usr/lib/systemd/systemd-time-wait-sync' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'busybox' will not be installed, because command 'busybox' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'dbus-daemon' will not be installed, because command 'dbus-daemon' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'rngd' will not be installed, because command 'rngd' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'connman' will not be installed, because command 'connmand' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'connman' will not be installed, because command 'connmanctl' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'connman' will not be installed, because command 'connmand-wait-online' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'network-wicked' will not be installed, because command 'wicked' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: Module 'ifcfg' will not be installed, because it's in the list to be omitted! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: Module 'plymouth' will not be installed, because it's in the list to be omitted! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: 62bluetooth: Could not find any command of '/usr/lib/bluetooth/bluetoothd /usr/libexec/bluetooth/bluetoothd'! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'lvmmerge' will not be installed, because command 'lvm' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'lvmthinpool-monitor' will not be installed, because command 'lvm' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'btrfs' will not be installed, because command 'btrfs' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'dmraid' will not be installed, because command 'dmraid' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'lvm' will not be installed, because command 'lvm' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'mdraid' will not be installed, because command 'mdadm' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'pcsc' will not be installed, because command 'pcscd' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'tpm2-tss' will not be installed, because command 'tpm2' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'cifs' will not be installed, because command 'mount.cifs' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'iscsi' will not be installed, because command 'iscsi-iname' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'iscsi' will not be installed, because command 'iscsiadm' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'iscsi' will not be installed, because command 'iscsid' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: dracut module 'nvmf' will not be installed, because command 'nvme' could not be found! Feb 20 19:01:02 np0005625471.novalocal dracut[1543]: Module 'resume' will not be installed, because it's in the list to be omitted! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'biosdevname' will not be installed, because command 'biosdevname' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: Module 'earlykdump' will not be installed, because it's in the list to be omitted! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'memstrack' will not be installed, because command 'memstrack' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: memstrack is not available Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: If you need to use rd.memdebug>=4, please install memstrack and procps-ng Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: Cannot change IRQ 25 affinity: Operation not permitted Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: IRQ 25 affinity is now unmanaged Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: Cannot change IRQ 31 affinity: Operation not permitted Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: IRQ 31 affinity is now unmanaged Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: Cannot change IRQ 28 affinity: Operation not permitted Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: IRQ 28 affinity is now unmanaged Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: Cannot change IRQ 32 affinity: Operation not permitted Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: IRQ 32 affinity is now unmanaged Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: Cannot change IRQ 30 affinity: Operation not permitted Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: IRQ 30 affinity is now unmanaged Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: Cannot change IRQ 29 affinity: Operation not permitted Feb 20 19:01:03 np0005625471.novalocal irqbalance[828]: IRQ 29 affinity is now unmanaged Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'systemd-resolved' will not be installed, because command 'resolvectl' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'systemd-resolved' will not be installed, because command '/usr/lib/systemd/systemd-resolved' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'systemd-timesyncd' will not be installed, because command '/usr/lib/systemd/systemd-timesyncd' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'systemd-timesyncd' will not be installed, because command '/usr/lib/systemd/systemd-time-wait-sync' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'busybox' will not be installed, because command 'busybox' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'dbus-daemon' will not be installed, because command 'dbus-daemon' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'rngd' will not be installed, because command 'rngd' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'connman' will not be installed, because command 'connmand' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'connman' will not be installed, because command 'connmanctl' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'connman' will not be installed, because command 'connmand-wait-online' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'network-wicked' will not be installed, because command 'wicked' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: 62bluetooth: Could not find any command of '/usr/lib/bluetooth/bluetoothd /usr/libexec/bluetooth/bluetoothd'! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'lvmmerge' will not be installed, because command 'lvm' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'lvmthinpool-monitor' will not be installed, because command 'lvm' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'btrfs' will not be installed, because command 'btrfs' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'dmraid' will not be installed, because command 'dmraid' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'lvm' will not be installed, because command 'lvm' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'mdraid' will not be installed, because command 'mdadm' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'pcsc' will not be installed, because command 'pcscd' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'tpm2-tss' will not be installed, because command 'tpm2' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'cifs' will not be installed, because command 'mount.cifs' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'iscsi' will not be installed, because command 'iscsi-iname' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'iscsi' will not be installed, because command 'iscsiadm' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'iscsi' will not be installed, because command 'iscsid' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'nvmf' will not be installed, because command 'nvme' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: dracut module 'memstrack' will not be installed, because command 'memstrack' could not be found! Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: memstrack is not available Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: If you need to use rd.memdebug>=4, please install memstrack and procps-ng Feb 20 19:01:03 np0005625471.novalocal dracut[1543]: *** Including module: systemd *** Feb 20 19:01:04 np0005625471.novalocal dracut[1543]: *** Including module: fips *** Feb 20 19:01:04 np0005625471.novalocal dracut[1543]: *** Including module: systemd-initrd *** Feb 20 19:01:04 np0005625471.novalocal dracut[1543]: *** Including module: i18n *** Feb 20 19:01:04 np0005625471.novalocal dracut[1543]: *** Including module: drm *** Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: *** Including module: prefixdevname *** Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: *** Including module: kernel-modules *** Feb 20 19:01:05 np0005625471.novalocal kernel: block vda: the capability attribute has been deprecated. Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: *** Including module: kernel-modules-extra *** Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: kernel-modules-extra: configuration source "/run/depmod.d" does not exist Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: kernel-modules-extra: configuration source "/lib/depmod.d" does not exist Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: kernel-modules-extra: parsing configuration file "/etc/depmod.d/dist.conf" Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: kernel-modules-extra: /etc/depmod.d/dist.conf: added "updates extra built-in weak-updates" to the list of search directories Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: *** Including module: qemu *** Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: *** Including module: fstab-sys *** Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: *** Including module: rootfs-block *** Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: *** Including module: terminfo *** Feb 20 19:01:05 np0005625471.novalocal dracut[1543]: *** Including module: udev-rules *** Feb 20 19:01:06 np0005625471.novalocal dracut[1543]: Skipping udev rule: 91-permissions.rules Feb 20 19:01:06 np0005625471.novalocal dracut[1543]: Skipping udev rule: 80-drivers-modprobe.rules Feb 20 19:01:06 np0005625471.novalocal dracut[1543]: *** Including module: virtiofs *** Feb 20 19:01:06 np0005625471.novalocal dracut[1543]: *** Including module: dracut-systemd *** Feb 20 19:01:06 np0005625471.novalocal dracut[1543]: *** Including module: usrmount *** Feb 20 19:01:06 np0005625471.novalocal dracut[1543]: *** Including module: base *** Feb 20 19:01:06 np0005625471.novalocal dracut[1543]: *** Including module: fs-lib *** Feb 20 19:01:06 np0005625471.novalocal dracut[1543]: *** Including module: kdumpbase *** Feb 20 19:01:06 np0005625471.novalocal systemd[1]: NetworkManager-dispatcher.service: Deactivated successfully. Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: *** Including module: microcode_ctl-fw_dir_override *** Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl module: mangling fw_dir Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: reset fw_dir to "/lib/firmware/updates /lib/firmware" Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-2d-07"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel-06-2d-07" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-4e-03"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel-06-4e-03" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-4f-01"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel-06-4f-01" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-55-04"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel-06-55-04" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-5e-03"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel-06-5e-03" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-8c-01"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel-06-8c-01" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-8e-9e-0x-0xca"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel-06-8e-9e-0x-0xca" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-8e-9e-0x-dell"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel-06-8e-9e-0x-dell" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: processing data directory "/usr/share/microcode_ctl/ucode_with_caveats/intel-06-8f-08"... Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: configuration "intel-06-8f-08" is ignored Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: microcode_ctl: final fw_dir: "/lib/firmware/updates /lib/firmware" Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: *** Including module: openssl *** Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: *** Including module: shutdown *** Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: *** Including module: squash *** Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: *** Including modules done *** Feb 20 19:01:07 np0005625471.novalocal dracut[1543]: *** Installing kernel module dependencies *** Feb 20 19:01:08 np0005625471.novalocal dracut[1543]: *** Installing kernel module dependencies done *** Feb 20 19:01:08 np0005625471.novalocal dracut[1543]: *** Resolving executable dependencies *** Feb 20 19:01:09 np0005625471.novalocal dracut[1543]: *** Resolving executable dependencies done *** Feb 20 19:01:09 np0005625471.novalocal dracut[1543]: *** Generating early-microcode cpio image *** Feb 20 19:01:09 np0005625471.novalocal dracut[1543]: *** Store current command line parameters *** Feb 20 19:01:09 np0005625471.novalocal dracut[1543]: Stored kernel commandline: Feb 20 19:01:09 np0005625471.novalocal dracut[1543]: No dracut internal kernel commandline stored in the initramfs Feb 20 19:01:09 np0005625471.novalocal dracut[1543]: *** Install squash loader *** Feb 20 19:01:10 np0005625471.novalocal sshd-session[4416]: Accepted publickey for zuul-worker from 38.102.83.114 port 41940 ssh2: RSA SHA256:zhs3MiW0JhxzckYcMHQES8SMYHj1iGcomnyzmbiwor8 Feb 20 19:01:10 np0005625471.novalocal systemd[1]: Created slice User Slice of UID 1000. Feb 20 19:01:10 np0005625471.novalocal systemd[1]: Starting User Runtime Directory /run/user/1000... Feb 20 19:01:10 np0005625471.novalocal systemd-logind[833]: New session 1 of user zuul-worker. Feb 20 19:01:10 np0005625471.novalocal systemd[1]: Finished User Runtime Directory /run/user/1000. Feb 20 19:01:10 np0005625471.novalocal systemd[1]: Starting User Manager for UID 1000... Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: pam_unix(systemd-user:session): session opened for user zuul-worker(uid=1000) by zuul-worker(uid=0) Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Queued start job for default target Main User Target. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Created slice User Application Slice. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Started Mark boot as successful after the user session has run 2 minutes. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Started Daily Cleanup of User's Temporary Directories. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Reached target Paths. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Reached target Timers. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Starting D-Bus User Message Bus Socket... Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Starting Create User's Volatile Files and Directories... Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Finished Create User's Volatile Files and Directories. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Listening on D-Bus User Message Bus Socket. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Reached target Sockets. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Reached target Basic System. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Reached target Main User Target. Feb 20 19:01:10 np0005625471.novalocal systemd[4488]: Startup finished in 146ms. Feb 20 19:01:10 np0005625471.novalocal systemd[1]: Started User Manager for UID 1000. Feb 20 19:01:10 np0005625471.novalocal systemd[1]: Started Session 1 of User zuul-worker. Feb 20 19:01:10 np0005625471.novalocal sshd-session[4416]: pam_unix(sshd:session): session opened for user zuul-worker(uid=1000) by zuul-worker(uid=0) Feb 20 19:01:10 np0005625471.novalocal dracut[1543]: *** Squashing the files inside the initramfs *** Feb 20 19:01:10 np0005625471.novalocal python3[4619]: ansible-setup Invoked with gather_subset=['!all'] gather_timeout=10 filter=[] fact_path=/etc/ansible/facts.d Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: *** Squashing the files inside the initramfs done *** Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: *** Creating image file '/boot/initramfs-5.14.0-681.el9.x86_64kdump.img' *** Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: *** Hardlinking files *** Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: Mode: real Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: Files: 50 Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: Linked: 0 files Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: Compared: 0 xattrs Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: Compared: 0 files Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: Saved: 0 B Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: Duration: 0.000529 seconds Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: *** Hardlinking files done *** Feb 20 19:01:11 np0005625471.novalocal dracut[1543]: *** Creating initramfs image file '/boot/initramfs-5.14.0-681.el9.x86_64kdump.img' done *** Feb 20 19:01:12 np0005625471.novalocal python3[4752]: ansible-ansible.legacy.setup Invoked with gather_subset=['all'] gather_timeout=10 filter=[] fact_path=/etc/ansible/facts.d Feb 20 19:01:12 np0005625471.novalocal kdumpctl[1027]: kdump: kexec: loaded kdump kernel Feb 20 19:01:12 np0005625471.novalocal kdumpctl[1027]: kdump: Starting kdump: [OK] Feb 20 19:01:12 np0005625471.novalocal systemd[1]: Finished Crash recovery kernel arming. Feb 20 19:01:12 np0005625471.novalocal systemd[1]: Startup finished in 1.626s (kernel) + 2.884s (initrd) + 21.621s (userspace) = 26.132s. Feb 20 19:01:16 np0005625471.novalocal python3[4987]: ansible-setup Invoked with gather_subset=['network'] gather_timeout=10 filter=[] fact_path=/etc/ansible/facts.d Feb 20 19:01:16 np0005625471.novalocal python3[5027]: ansible-zuul_console Invoked with path=/tmp/console-{log_uuid}.log port=19885 state=present Feb 20 19:01:18 np0005625471.novalocal python3[5053]: ansible-authorized_key Invoked with user=zuul-worker state=present key=ssh-rsa AAAAB3NzaC1yc2EAAAADAQABAAABgQC5agdPtcugrDYjIXUSZL1sGjsLZ+/5ljexg1jZeEkB9TA5QouKdUXTokea7pj6MfADOtRUjcRlP6kJQ5na0Eq0v6kjxMirgaX7TX5XkWWrkaOqqRdb8XG6dk/Q5Ynm1DmBehp6evSHjNy9j1D7U8M+zjL4CPDP7HY/diKiKXnC+kr5IOQm97pILdfgm0mrbXlfvkqXzW/od2qJ9EU4GyyjNccYvB/Vatu9jKDeUdjpWq0NigjIHDGpy+59jm58yOSxrF02HEy43w2u1epKty2E7VyB9GJjYKgYvTvkrtYlx+zxo2bkImqxKMExViqjk/xYgpbC7ydB6bWwFHpz+h3p3NkSak9/aAQNrf5anyzkDFHHybPLXQnZyVoBgormKPwqtDbw65VreTDflYC0lK1bu3bkuJuV0DI5tTFKGBcV+NrGsxgBUw8RCGxUJK+8dZweF7BtNnS/grtKqPygiX1WGA4jDCvIWgCeGXd0siI91gFDlgKRcC1Pt3jc87R5V60= zuul-build-sshkey manage_dir=True exclusive=False validate_certs=True follow=False path=None key_options=None comment=None Feb 20 19:01:18 np0005625471.novalocal python3[5077]: ansible-file Invoked with state=directory path=/home/zuul-worker/.ssh mode=448 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:19 np0005625471.novalocal python3[5176]: ansible-ansible.legacy.stat Invoked with path=/home/zuul-worker/.ssh/id_rsa follow=False get_checksum=False checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Feb 20 19:01:19 np0005625471.novalocal python3[5247]: ansible-ansible.legacy.copy Invoked with src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1771632078.958029-163-233509680431140/source dest=/home/zuul-worker/.ssh/id_rsa mode=384 force=False _original_basename=af40493b01ed4c2984b2c682a37e8dc5_id_rsa follow=False checksum=1acc24321c17225a74e41cd49f0b9e70c5a56e5c backup=False unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:20 np0005625471.novalocal python3[5370]: ansible-ansible.legacy.stat Invoked with path=/home/zuul-worker/.ssh/id_rsa.pub follow=False get_checksum=False checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Feb 20 19:01:20 np0005625471.novalocal python3[5441]: ansible-ansible.legacy.copy Invoked with src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1771632079.8029346-174-202804213917616/source dest=/home/zuul-worker/.ssh/id_rsa.pub mode=420 force=False _original_basename=af40493b01ed4c2984b2c682a37e8dc5_id_rsa.pub follow=False checksum=76d54d93177a900b06f83ad02277862eb7d4e9c3 backup=False unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:21 np0005625471.novalocal python3[5489]: ansible-ping Invoked with data=pong Feb 20 19:01:22 np0005625471.novalocal python3[5513]: ansible-setup Invoked with gather_subset=['all'] gather_timeout=10 filter=[] fact_path=/etc/ansible/facts.d Feb 20 19:01:23 np0005625471.novalocal python3[5571]: ansible-zuul_debug_info Invoked with ipv4_route_required=False ipv6_route_required=False image_manifest_files=['/etc/dib-builddate.txt', '/etc/image-hostname.txt'] image_manifest=None traceroute_host=None Feb 20 19:01:24 np0005625471.novalocal python3[5603]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/logs state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:24 np0005625471.novalocal python3[5627]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/artifacts state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:24 np0005625471.novalocal python3[5651]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/docs state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:25 np0005625471.novalocal python3[5675]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/logs state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:25 np0005625471.novalocal python3[5699]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/artifacts state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:25 np0005625471.novalocal python3[5723]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/docs state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:26 np0005625471.novalocal systemd[1]: systemd-hostnamed.service: Deactivated successfully. Feb 20 19:01:29 np0005625471.novalocal python3[5749]: ansible-zuul_console Invoked with path=/tmp/console-{log_uuid}.log port=19885 state=present Feb 20 19:01:29 np0005625471.novalocal sshd-session[5752]: Accepted publickey for zuul-worker from 38.102.83.114 port 60126 ssh2: RSA SHA256:A89Ox9lWx8ERYObs8BIVr5YimBDPNMqDUz6shUGufdM Feb 20 19:01:29 np0005625471.novalocal systemd-logind[833]: New session 3 of user zuul-worker. Feb 20 19:01:29 np0005625471.novalocal systemd[1]: Started Session 3 of User zuul-worker. Feb 20 19:01:29 np0005625471.novalocal sshd-session[5752]: pam_unix(sshd:session): session opened for user zuul-worker(uid=1000) by zuul-worker(uid=0) Feb 20 19:01:32 np0005625471.novalocal sshd-session[5755]: Received disconnect from 38.102.83.114 port 60126:11: disconnected by user Feb 20 19:01:32 np0005625471.novalocal sshd-session[5755]: Disconnected from user zuul-worker 38.102.83.114 port 60126 Feb 20 19:01:32 np0005625471.novalocal sshd-session[5752]: pam_unix(sshd:session): session closed for user zuul-worker Feb 20 19:01:32 np0005625471.novalocal systemd[1]: session-3.scope: Deactivated successfully. Feb 20 19:01:32 np0005625471.novalocal systemd[1]: session-3.scope: Consumed 1.213s CPU time. Feb 20 19:01:32 np0005625471.novalocal systemd-logind[833]: Session 3 logged out. Waiting for processes to exit. Feb 20 19:01:32 np0005625471.novalocal systemd-logind[833]: Removed session 3. Feb 20 19:01:33 np0005625471.novalocal python3[5803]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/logs state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:33 np0005625471.novalocal python3[5827]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/artifacts state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:33 np0005625471.novalocal python3[5851]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/docs state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:34 np0005625471.novalocal python3[5875]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/logs state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:34 np0005625471.novalocal python3[5899]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/artifacts state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:34 np0005625471.novalocal python3[5923]: ansible-file Invoked with path=/home/zuul-worker/zuul-output/docs state=directory mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:35 np0005625471.novalocal python3[5948]: ansible-ansible.legacy.command Invoked with _raw_params=sudo -n true zuul_log_id=fa163efc-24cc-636a-9524-000000000028-1-cloudcentos9stream zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:01:35 np0005625471.novalocal sudo[5949]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/true Feb 20 19:01:35 np0005625471.novalocal sudo[5949]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:35 np0005625471.novalocal sudo[5949]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:35 np0005625471.novalocal python3[5977]: ansible-file Invoked with path=/home/zuul-worker/.pydistutils.cfg state=absent recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:36 np0005625471.novalocal sudo[6053]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yeuoehrygswizaeoiaqqypcrobvahjch ; /usr/bin/python3' Feb 20 19:01:36 np0005625471.novalocal sudo[6053]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:36 np0005625471.novalocal python3[6055]: ansible-ansible.legacy.stat Invoked with path=/etc/pip.conf follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Feb 20 19:01:36 np0005625471.novalocal sudo[6053]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:36 np0005625471.novalocal sudo[6126]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pfwvnarjnewjdqehigdwhlztibjzcqfd ; /usr/bin/python3' Feb 20 19:01:36 np0005625471.novalocal sudo[6126]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:36 np0005625471.novalocal python3[6128]: ansible-ansible.legacy.copy Invoked with dest=/etc/pip.conf group=root mode=420 owner=root src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1771632095.9802513-91-261812456142822/source follow=False _original_basename=pip.conf.j2 checksum=5b65c9094402b8db60a77928be1f816342638afe backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:36 np0005625471.novalocal sudo[6126]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:37 np0005625471.novalocal sudo[6228]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zsgxhgtdtuirmixhkcikdfdhbhgwgzdv ; /usr/bin/python3' Feb 20 19:01:37 np0005625471.novalocal sudo[6228]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:37 np0005625471.novalocal python3[6230]: ansible-ansible.legacy.stat Invoked with path=/etc/yum.repos.d/centos.repo follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Feb 20 19:01:37 np0005625471.novalocal sudo[6228]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:37 np0005625471.novalocal sudo[6303]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rncboitwxybnbsmgtpwzfewucxiptgii ; /usr/bin/python3' Feb 20 19:01:37 np0005625471.novalocal sudo[6303]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:37 np0005625471.novalocal python3[6305]: ansible-ansible.legacy.copy Invoked with dest=/etc/yum.repos.d/centos.repo group=root mode=420 owner=root src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1771632097.0939796-103-121859135896584/source follow=False _original_basename=centos.repo.j2 checksum=0268eb1686bc9b047a2096dbaf287658b0d20a19 backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:37 np0005625471.novalocal sudo[6303]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:37 np0005625471.novalocal sudo[6405]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kniwlmdosjqqoghzehdjyescdwekirah ; /usr/bin/python3' Feb 20 19:01:37 np0005625471.novalocal sudo[6405]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:38 np0005625471.novalocal python3[6407]: ansible-ansible.legacy.stat Invoked with path=/etc/yum.repos.d/centos-addons.repo follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Feb 20 19:01:38 np0005625471.novalocal sudo[6405]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:38 np0005625471.novalocal sudo[6480]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rziglhjtgslliovaoshfzmtrutayxiqv ; /usr/bin/python3' Feb 20 19:01:38 np0005625471.novalocal sudo[6480]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:38 np0005625471.novalocal python3[6482]: ansible-ansible.legacy.copy Invoked with dest=/etc/yum.repos.d/centos-addons.repo group=root mode=420 owner=root src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1771632097.836844-103-95671321962344/source follow=False _original_basename=centos-addons.repo.j2 checksum=2917e612982cadeb3009a3bf37bf30cbcd7f2044 backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:38 np0005625471.novalocal sudo[6480]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:38 np0005625471.novalocal sudo[6530]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mqrlxkacrbpyadtxjouehjuobeccmnbq ; /usr/bin/python3' Feb 20 19:01:38 np0005625471.novalocal sudo[6530]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:39 np0005625471.novalocal python3[6532]: ansible-ini_file Invoked with path=/etc/dnf.conf section=main option=deltarpm value=0 mode=420 backup=False state=present exclusive=True no_extra_spaces=False ignore_spaces=False allow_no_value=False create=True follow=False unsafe_writes=False values=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:39 np0005625471.novalocal python3[6532]: ansible-ini_file [WARNING] Module remote_tmp /root/.ansible/tmp did not exist and was created with a mode of 0700, this may cause issues when running as another user. To avoid this, create the remote_tmp dir with the correct permissions manually Feb 20 19:01:39 np0005625471.novalocal sudo[6530]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:39 np0005625471.novalocal sudo[6556]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qyaekvrloblfxstwsonhbukezsuheduu ; /usr/bin/python3' Feb 20 19:01:39 np0005625471.novalocal sudo[6556]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:39 np0005625471.novalocal python3[6558]: ansible-ansible.legacy.command Invoked with _raw_params=dnf clean all zuul_log_id=in-loop-ignore zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:01:39 np0005625471.novalocal sudo[6556]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:40 np0005625471.novalocal sudo[6584]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ukluqedmraroubewtnxwcqqzzgzoywrk ; /usr/bin/python3' Feb 20 19:01:40 np0005625471.novalocal sudo[6584]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:40 np0005625471.novalocal python3[6586]: ansible-ansible.legacy.command Invoked with _raw_params=dnf makecache -v zuul_log_id=in-loop-ignore zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:01:50 np0005625471.novalocal sudo[6584]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:52 np0005625471.novalocal python3[6627]: ansible-file Invoked with path=/home/zuul-worker/workspace state=directory recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:01:53 np0005625471.novalocal python3[6652]: ansible-ansible.legacy.command Invoked with executable=/bin/bash _raw_params=PYTHON2=0 PYTHON3=1 # Not all platforms install a `pip` when installing python # specific pip packages. We first check if pip$VERSION is # available and if not fallback to checking if just `pip` # is present. if [ "$PYTHON2" -eq "1" ] ; then command -v pip2 || command -v pip || exit 1 python2 -m wheel --help || exit 1 fi if [ "$PYTHON3" -eq "1" ] ; then command -v pip3 || command -v pip || exit 1 python3 -m wheel --help || exit 1 fi _uses_shell=True zuul_log_id=fa163efc-24cc-8f66-94ad-0000000000a3-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None creates=None removes=None stdin=None Feb 20 19:01:54 np0005625471.novalocal sudo[6680]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fphtgukchxbcxgzqnavuyztcxjuknwgn ; /usr/bin/python3' Feb 20 19:01:54 np0005625471.novalocal sudo[6680]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:01:54 np0005625471.novalocal python3[6682]: ansible-ansible.legacy.dnf Invoked with name=['python3-pip', 'python3-setuptools', 'python3-wheel'] state=present allow_downgrade=False autoremove=False bugfix=False cacheonly=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True sslverify=True lock_timeout=30 allowerasing=False nobest=False use_backend=auto conf_file=None disable_excludes=None download_dir=None list=None releasever=None Feb 20 19:01:56 np0005625471.novalocal sudo[6680]: pam_unix(sudo:session): session closed for user root Feb 20 19:01:57 np0005625471.novalocal python3[6714]: ansible-ansible.legacy.command Invoked with executable=/bin/bash _raw_params=command -v python3 _uses_shell=True zuul_log_id=fa163efc-24cc-8f66-94ad-0000000000ad-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None creates=None removes=None stdin=None Feb 20 19:01:57 np0005625471.novalocal python3[6742]: ansible-ansible.legacy.command Invoked with executable=/bin/bash _raw_params=command -v tox /home/zuul-worker/.local/tox/bin/tox || exit 1 _uses_shell=True zuul_log_id=fa163efc-24cc-8f66-94ad-000000000033-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None creates=None removes=None stdin=None Feb 20 19:01:58 np0005625471.novalocal python3[6770]: ansible-ansible.legacy.command Invoked with _raw_params=/usr/bin/python3 -m venv /home/zuul-worker/.local/tox zuul_log_id=fa163efc-24cc-8f66-94ad-000000000036-1-cloudcentos9stream zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:02:01 np0005625471.novalocal python3[6802]: ansible-ansible.legacy.command Invoked with _raw_params=/home/zuul-worker/.local/tox/bin/pip install tox zuul_log_id=fa163efc-24cc-8f66-94ad-000000000037-1-cloudcentos9stream zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:02:06 np0005625471.novalocal python3[6832]: ansible-ansible.legacy.command Invoked with _raw_params=/home/zuul-worker/.local/tox/bin/tox --version zuul_log_id=fa163efc-24cc-8f66-94ad-00000000003a-1-cloudcentos9stream zuul_ansible_split_streams=False _uses_shell=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:02:06 np0005625471.novalocal sudo[6859]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cjmdpgfkmlkvlvbgmgejqkykxfksmezf ; /usr/bin/python3' Feb 20 19:02:06 np0005625471.novalocal sudo[6859]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:02:06 np0005625471.novalocal python3[6861]: ansible-file Invoked with state=link src=/home/zuul-worker/.local/tox/bin/tox dest=/usr/local/bin/tox path=/usr/local/bin/tox recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:02:06 np0005625471.novalocal sudo[6859]: pam_unix(sudo:session): session closed for user root Feb 20 19:02:06 np0005625471.novalocal python3[6886]: ansible-ansible.legacy.command Invoked with _raw_params=export WBASE="/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo"; mkdir -p $WBASE/playbooks/roles ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-common" $WBASE/playbooks/roles/common; # noqa 204 ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-logs" $WBASE/playbooks/roles/logs; # noqa 204 ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-kolla" $WBASE/playbooks/roles/kolla; # noqa 204 ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-packstack" $WBASE/playbooks/roles/packstack; # noqa 204 ln -s "/home/zuul-worker/src/review.rdoproject.org/rdo-infra/ansible-role-weirdo-puppet-openstack" $WBASE/playbooks/roles/puppet-openstack; # noqa 204 ln -s "/home/zuul-worker/src/github.com/openstack-k8s-operators/ci-framework/roles/build_containers" $WBASE/playbooks/roles/build_containers; # noqa 204 _uses_shell=True zuul_log_id=fa163efc-24cc-8f66-94ad-000000000051-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:02:07 np0005625471.novalocal sudo[6919]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-psivqnqzlyaejgsrfjtpirwismetsfmy ; /usr/bin/python3' Feb 20 19:02:07 np0005625471.novalocal sudo[6919]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:02:07 np0005625471.novalocal python3[6921]: ansible-file Invoked with path=/etc/ci state=directory owner=root group=root mode=493 recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:02:07 np0005625471.novalocal sudo[6919]: pam_unix(sudo:session): session closed for user root Feb 20 19:02:07 np0005625471.novalocal sudo[6997]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-axyttduvumfxyilifcfdpzxnvokveuki ; /usr/bin/python3' Feb 20 19:02:07 np0005625471.novalocal sudo[6997]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:02:08 np0005625471.novalocal python3[6999]: ansible-ansible.legacy.stat Invoked with path=/etc/ci/mirror_info.sh follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Feb 20 19:02:08 np0005625471.novalocal sudo[6997]: pam_unix(sudo:session): session closed for user root Feb 20 19:02:08 np0005625471.novalocal sudo[7070]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ksndegzhnhblpeifjgnefjlshizzcnsz ; /usr/bin/python3' Feb 20 19:02:08 np0005625471.novalocal sudo[7070]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:02:08 np0005625471.novalocal python3[7072]: ansible-ansible.legacy.copy Invoked with dest=/etc/ci/mirror_info.sh owner=root group=root mode=420 src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1771632127.6762478-85-243627362266913/source follow=False _original_basename=mirror_info.sh.j2 checksum=ea5d641d750b2605d80a15d4106dfb6027081c92 backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None seuser=None serole=None selevel=None setype=None attributes=None Feb 20 19:02:08 np0005625471.novalocal sudo[7070]: pam_unix(sudo:session): session closed for user root Feb 20 19:02:08 np0005625471.novalocal sudo[7121]: zuul-worker : PWD=/home/zuul-worker ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rflckckfcpezypuludukinmprezupsxj ; /usr/bin/python3' Feb 20 19:02:08 np0005625471.novalocal sudo[7121]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:02:08 np0005625471.novalocal python3[7123]: ansible-ansible.legacy.command Invoked with _raw_params=dnf install -y python3-pip rpmlint python3-rpm _uses_shell=True zuul_log_id=fa163efc-24cc-8f66-94ad-000000000064-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:02:09 np0005625471.novalocal sudo[7121]: pam_unix(sudo:session): session closed for user root Feb 20 19:02:10 np0005625471.novalocal python3[7150]: ansible-pip Invoked with name=['rdopkg'] virtualenv=/home/zuul-worker/rdopkg-venv virtualenv_command=/usr/bin/python3 -m venv virtualenv_site_packages=True state=present editable=False version=None requirements=None virtualenv_python=None extra_args=None chdir=None executable=None umask=None Feb 20 19:02:18 np0005625471.novalocal python3[7185]: ansible-ansible.legacy.command Invoked with _raw_params=set -e -x source '/home/zuul-worker/rdopkg-venv/bin/activate' MASTER="$(rdopkg info | grep -e "in development phase" | awk '{print $1}')" RELEASE="antelope" PHASE="release" PROJECT="rdoinfo" DIST_VER="9" case $PROJECT in rdoinfo) REPO="cloud${DIST_VER}-openstack-$RELEASE-$PHASE" ;; nfvinfo) REPO="nfv${DIST_VER}-openvswitch-2-$PHASE" ;; esac # Find out if it is puppet or packstack and scenario if [[ "periodic-cloudsig-antelope-release-packstack-scenario002-centos9" == *"puppet"* ]]; then project="puppet-openstack" elif [[ "periodic-cloudsig-antelope-release-packstack-scenario002-centos9" == *"tcib-container-build"* ]]; then project="tcib-container-build" else project="packstack" fi scenario="scenario002" # Set version related variables if [ $RELEASE = $MASTER ]; then VERSION="master" O_RELEASE="master" else VERSION="$(rdopkg release -r "$RELEASE" | grep upstream_branch | awk '{print $2}')" O_RELEASE="$RELEASE" fi # Prepare Ansible inventory to use localhost pushd /home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo cat <hosts localhost ansible_connection=local ansible_python_interpreter=/usr/bin/python3 [openstack_nodes] localhost log_destination=/var/log/weirdo EOF case $PHASE in testing) REPOS_URL="http://trunk.rdoproject.org/centos9-${O_RELEASE}/puppet-passed-ci/delorean.repo,https://trunk.rdoproject.org/centos9-${O_RELEASE}/delorean-deps.repo" # noqa 204 ADDITIONAL_OPTS="" ;; release) if [ $RELEASE = $MASTER ]; then REPOS_URL="http://trunk.rdoproject.org/centos9-master/puppet-passed-ci/delorean.repo,https://trunk.rdoproject.org/centos9-master/delorean-deps.repo" # noqa 204 ADDITIONAL_OPTS="" else REPOS_URL="$TEMP_REPO_URL" ADDITIONAL_OPTS="-e stable_repositories=centos-release-openstack-${RELEASE} -e testing_repository=false" fi ;; esac tox -e ansible-playbook -- -vv -b -i hosts playbooks/$project-$scenario.yml \ -e version=$VERSION \ -e openstack_release=$O_RELEASE \ -e selinux_enforcing="false" \ -e tempest_from_source=false \ -e enable_puppet_modules_rpm=true \ $ADDITIONAL_OPTS _uses_shell=True zuul_log_id=fa163efc-24cc-8f66-94ad-00000000000d-1-cloudcentos9stream zuul_ansible_split_streams=False warn=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:03:36 np0005625471.novalocal sudo[7542]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rtfgzvdgqvvytddirzmgkdigowanxnvg ; /usr/bin/python3' Feb 20 19:03:36 np0005625471.novalocal sudo[7542]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:36 np0005625471.novalocal python3[7544]: ansible-setup Invoked with gather_subset=['all'] gather_timeout=10 filter=* fact_path=/etc/ansible/facts.d Feb 20 19:03:36 np0005625471.novalocal sudo[7542]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:37 np0005625471.novalocal sudo[7583]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-imayntuanrqwlggkeqiekdzjuftfnhob ; /usr/bin/python3' Feb 20 19:03:37 np0005625471.novalocal sudo[7583]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:37 np0005625471.novalocal python3[7585]: ansible-command Invoked with _raw_params=sudo dnf config-manager --enable crb _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:03:37 np0005625471.novalocal python3[7585]: ansible-command [WARNING] Consider using 'become', 'become_method', and 'become_user' rather than running sudo Feb 20 19:03:37 np0005625471.novalocal sudo[7586]: root : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/dnf config-manager --enable crb Feb 20 19:03:37 np0005625471.novalocal sudo[7586]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:03:37 np0005625471.novalocal sudo[7586]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:37 np0005625471.novalocal sudo[7583]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:37 np0005625471.novalocal sudo[7597]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wlolyxuyzijjjhksiwjfqgwlgcdsrsan ; /usr/bin/python3' Feb 20 19:03:37 np0005625471.novalocal sudo[7597]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:38 np0005625471.novalocal python3[7599]: ansible-systemd Invoked with name=firewalld state=stopped daemon_reload=False daemon_reexec=False no_block=False enabled=None force=None masked=None user=None scope=None Feb 20 19:03:38 np0005625471.novalocal sudo[7597]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:38 np0005625471.novalocal sudo[7609]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gdeinxzkhtgrgvzqlhxpjimahnqtitla ; /usr/bin/python3' Feb 20 19:03:38 np0005625471.novalocal sudo[7609]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:38 np0005625471.novalocal python3[7611]: ansible-dnf Invoked with name=['firewalld'] state=absent allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Feb 20 19:03:39 np0005625471.novalocal sudo[7609]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:39 np0005625471.novalocal sudo[7627]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-knlelbjzencwpuooanxfofnyfwnocuhj ; /usr/bin/python3' Feb 20 19:03:39 np0005625471.novalocal sudo[7627]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:39 np0005625471.novalocal python3[7629]: ansible-dnf Invoked with name=['tuned', 'subscription-manager'] state=present allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Feb 20 19:03:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:03:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:03:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:03:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:03:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:03:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:03:42 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:03:42 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:03:42 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:03:42 np0005625471.novalocal systemd-rc-local-generator[7697]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:03:43 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:03:45 np0005625471.novalocal sudo[7627]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:45 np0005625471.novalocal sudo[9861]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fsrejxralrkvldymcxxlerrxccyprvxh ; /usr/bin/python3' Feb 20 19:03:45 np0005625471.novalocal sudo[9861]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:45 np0005625471.novalocal python3[9897]: ansible-systemd Invoked with name=tuned enabled=True state=started daemon_reload=False daemon_reexec=False no_block=False force=None masked=None user=None scope=None Feb 20 19:03:45 np0005625471.novalocal systemd[1]: Starting Dynamic System Tuning Daemon... Feb 20 19:03:45 np0005625471.novalocal systemd[1]: Starting Authorization Manager... Feb 20 19:03:45 np0005625471.novalocal systemd[1]: Started Dynamic System Tuning Daemon. Feb 20 19:03:45 np0005625471.novalocal sudo[9861]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:45 np0005625471.novalocal polkitd[11012]: Started polkitd version 0.117 Feb 20 19:03:45 np0005625471.novalocal polkitd[11012]: Loading rules from directory /etc/polkit-1/rules.d Feb 20 19:03:45 np0005625471.novalocal polkitd[11012]: Loading rules from directory /usr/share/polkit-1/rules.d Feb 20 19:03:45 np0005625471.novalocal polkitd[11012]: Finished loading, compiling and executing 2 rules Feb 20 19:03:45 np0005625471.novalocal polkitd[11012]: Acquired the name org.freedesktop.PolicyKit1 on the system bus Feb 20 19:03:45 np0005625471.novalocal systemd[1]: Started Authorization Manager. Feb 20 19:03:45 np0005625471.novalocal sudo[11137]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-slwstjbikgcnhclmvennpvizmbbkhymc ; /usr/bin/python3' Feb 20 19:03:45 np0005625471.novalocal sudo[11137]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:46 np0005625471.novalocal python3[11152]: ansible-command Invoked with _raw_params=tuned-adm active warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:03:46 np0005625471.novalocal sudo[11137]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:46 np0005625471.novalocal systemd[4488]: Starting Mark boot as successful... Feb 20 19:03:46 np0005625471.novalocal systemd[4488]: Finished Mark boot as successful. Feb 20 19:03:46 np0005625471.novalocal sudo[11576]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kibljmhupmpxzbehlwnhnikzjhdypdgq ; /usr/bin/python3' Feb 20 19:03:46 np0005625471.novalocal sudo[11576]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:46 np0005625471.novalocal python3[11598]: ansible-command Invoked with _raw_params=tuned-adm profile throughput-performance warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:03:47 np0005625471.novalocal sudo[11576]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:47 np0005625471.novalocal sudo[12962]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-iiehuoymcrrsuvyrtwglhvvrbcjrzmtp ; /usr/bin/python3' Feb 20 19:03:47 np0005625471.novalocal sudo[12962]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:48 np0005625471.novalocal python3[12983]: ansible-file Invoked with path=/var/log/weirdo state=directory recurse=True force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None content=NOT_LOGGING_PARAMETER backup=None remote_src=None regexp=None delimiter=None directory_mode=None Feb 20 19:03:48 np0005625471.novalocal sudo[12962]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:48 np0005625471.novalocal sudo[13246]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-shfoafrkxdtutldipixbhescsjjmlbzp ; /usr/bin/python3' Feb 20 19:03:48 np0005625471.novalocal sudo[13246]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:48 np0005625471.novalocal python3[13255]: ansible-file Invoked with path=/var/log/weirdo-project state=directory recurse=True force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None content=NOT_LOGGING_PARAMETER backup=None remote_src=None regexp=None delimiter=None directory_mode=None Feb 20 19:03:48 np0005625471.novalocal sudo[13246]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:48 np0005625471.novalocal sudo[13584]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hcieqqjmouecsouxyyymhccakwzvqxrg ; /usr/bin/python3' Feb 20 19:03:48 np0005625471.novalocal sudo[13584]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:48 np0005625471.novalocal python3[13586]: ansible-dnf Invoked with name=['centos-release-openstack-antelope'] state=present disable_gpg_check=True allow_downgrade=False autoremove=False bugfix=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Feb 20 19:03:50 np0005625471.novalocal sudo[13584]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:50 np0005625471.novalocal sudo[14362]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-eovyowsxwjtefalxtkmabhehnyibacgp ; /usr/bin/python3' Feb 20 19:03:50 np0005625471.novalocal sudo[14362]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:50 np0005625471.novalocal python3[14373]: ansible-command Invoked with _raw_params=yum-config-manager --disable rdo-trunk-antelope-tested\* warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:03:50 np0005625471.novalocal sudo[14362]: pam_unix(sudo:session): session closed for user root Feb 20 19:03:51 np0005625471.novalocal sudo[14721]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qujnvhaajqdgklwszsivadawvgzfklmw ; /usr/bin/python3' Feb 20 19:03:51 np0005625471.novalocal sudo[14721]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:03:51 np0005625471.novalocal python3[14736]: ansible-command Invoked with _raw_params=IS_CEPH_INSTALLED=$(rpm -qa | grep centos-release-ceph) if [ -n ${IS_CEPH_INSTALLED} ]; then dnf install -y 'dnf-command(config-manager)' dnf config-manager --enable crb dnf install -y epel-release dnf config-manager --disable epel-next dnf config-manager --disable epel-cisco-openh264 dnf config-manager --setopt epel.priority=100 --save epel dnf config-manager --setopt epel.includepkgs="libarrow*,parquet*,python3-asyncssh,re2,python3-grpcio,grpc*,abseil*" --save epel fi _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:03:58 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:03:58 np0005625471.novalocal systemd-rc-local-generator[18243]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:03:58 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:04:00 np0005625471.novalocal sudo[14721]: pam_unix(sudo:session): session closed for user root Feb 20 19:04:00 np0005625471.novalocal sudo[19313]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wgkzutrqksoaafmomfdgazbfrfsjbxgv ; /usr/bin/python3' Feb 20 19:04:00 np0005625471.novalocal sudo[19313]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:04:00 np0005625471.novalocal python3[19325]: ansible-command Invoked with _raw_params=dnf clean all _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:04:00 np0005625471.novalocal python3[19325]: ansible-command [WARNING] Consider using the dnf module rather than running 'dnf'. If you need to use command because dnf is insufficient you can add 'warn: false' to this command task or set 'command_warnings=False' in ansible.cfg to get rid of this message. Feb 20 19:04:01 np0005625471.novalocal sudo[19313]: pam_unix(sudo:session): session closed for user root Feb 20 19:04:01 np0005625471.novalocal sudo[19709]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vzvprotdsikbviykzrvsupynxsrrtsii ; /usr/bin/python3' Feb 20 19:04:01 np0005625471.novalocal sudo[19709]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:04:01 np0005625471.novalocal python3[19724]: ansible-dnf Invoked with name=['*'] state=latest allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Feb 20 19:04:13 np0005625471.novalocal irqbalance[828]: Cannot change IRQ 27 affinity: Operation not permitted Feb 20 19:04:13 np0005625471.novalocal irqbalance[828]: IRQ 27 affinity is now unmanaged Feb 20 19:04:17 np0005625471.novalocal chronyd[840]: Selected source 23.128.92.19 (2.centos.pool.ntp.org) Feb 20 19:04:20 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:04:20 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:04:20 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Consumed 42.801s CPU time. Feb 20 19:04:20 np0005625471.novalocal systemd[1]: run-r2e7321c15a214664a3ce501fa371bf99.service: Deactivated successfully. Feb 20 19:04:27 np0005625471.novalocal sudo[19709]: pam_unix(sudo:session): session closed for user root Feb 20 19:04:27 np0005625471.novalocal sudo[28389]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ihdnbowrwzguepmirdkgighoidvcvrwz ; /usr/bin/python3' Feb 20 19:04:27 np0005625471.novalocal sudo[28389]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:04:27 np0005625471.novalocal python3[28391]: ansible-dnf Invoked with name=['gettext', 'diffstat', 'doxygen', 'patch', 'patchutils', 'subversion', 'systemtap', 'git', 'wget', 'python3-libselinux', 'python3-setuptools', 'rubygem-rexml'] state=present allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Feb 20 19:04:45 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:04:45 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:04:45 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:22 np0005625471.novalocal groupadd[45499]: group added to /etc/group: name=rtkit, GID=172 Feb 20 19:05:22 np0005625471.novalocal groupadd[45499]: group added to /etc/gshadow: name=rtkit Feb 20 19:05:22 np0005625471.novalocal groupadd[45499]: new group: name=rtkit, GID=172 Feb 20 19:05:22 np0005625471.novalocal useradd[45507]: new user: name=rtkit, UID=172, GID=172, home=/, shell=/sbin/nologin, from=none Feb 20 19:05:22 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:22 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:22 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:23 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:23 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:34 np0005625471.novalocal kernel: SELinux: Converting 448 SID table entries... Feb 20 19:05:34 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:05:34 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:05:34 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:05:34 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:05:34 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:05:34 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:05:34 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:05:42 np0005625471.novalocal groupadd[45578]: group added to /etc/group: name=geoclue, GID=994 Feb 20 19:05:42 np0005625471.novalocal groupadd[45578]: group added to /etc/gshadow: name=geoclue Feb 20 19:05:42 np0005625471.novalocal groupadd[45578]: new group: name=geoclue, GID=994 Feb 20 19:05:42 np0005625471.novalocal useradd[45585]: new user: name=geoclue, UID=993, GID=994, home=/var/lib/geoclue, shell=/sbin/nologin, from=none Feb 20 19:05:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:42 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=2 res=1 Feb 20 19:05:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Reloading rules Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Collecting garbage unconditionally... Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Loading rules from directory /etc/polkit-1/rules.d Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Loading rules from directory /usr/share/polkit-1/rules.d Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Finished loading, compiling and executing 3 rules Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Reloading rules Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Collecting garbage unconditionally... Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Loading rules from directory /etc/polkit-1/rules.d Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Loading rules from directory /usr/share/polkit-1/rules.d Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Finished loading, compiling and executing 3 rules Feb 20 19:05:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:42 np0005625471.novalocal groupadd[45597]: group added to /etc/group: name=flatpak, GID=993 Feb 20 19:05:42 np0005625471.novalocal groupadd[45597]: group added to /etc/gshadow: name=flatpak Feb 20 19:05:42 np0005625471.novalocal groupadd[45597]: new group: name=flatpak, GID=993 Feb 20 19:05:42 np0005625471.novalocal useradd[45604]: new user: name=flatpak, UID=992, GID=993, home=/, shell=/usr/sbin/nologin, from=none Feb 20 19:05:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:42 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Reloading rules Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Collecting garbage unconditionally... Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Loading rules from directory /etc/polkit-1/rules.d Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Loading rules from directory /usr/share/polkit-1/rules.d Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Finished loading, compiling and executing 4 rules Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Reloading rules Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Collecting garbage unconditionally... Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Loading rules from directory /etc/polkit-1/rules.d Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Loading rules from directory /usr/share/polkit-1/rules.d Feb 20 19:05:42 np0005625471.novalocal polkitd[11012]: Finished loading, compiling and executing 4 rules Feb 20 19:05:43 np0005625471.novalocal sshd[1019]: Received signal 15; terminating. Feb 20 19:05:43 np0005625471.novalocal systemd[1]: Stopping OpenSSH server daemon... Feb 20 19:05:43 np0005625471.novalocal systemd[1]: sshd.service: Deactivated successfully. Feb 20 19:05:43 np0005625471.novalocal systemd[1]: Stopped OpenSSH server daemon. Feb 20 19:05:43 np0005625471.novalocal systemd[1]: Stopped target sshd-keygen.target. Feb 20 19:05:43 np0005625471.novalocal systemd[1]: Stopping sshd-keygen.target... Feb 20 19:05:43 np0005625471.novalocal systemd[1]: OpenSSH ecdsa Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Feb 20 19:05:43 np0005625471.novalocal systemd[1]: OpenSSH ed25519 Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Feb 20 19:05:43 np0005625471.novalocal systemd[1]: OpenSSH rsa Server Key Generation was skipped because of an unmet condition check (ConditionPathExists=!/run/systemd/generator.early/multi-user.target.wants/cloud-init.target). Feb 20 19:05:43 np0005625471.novalocal systemd[1]: Reached target sshd-keygen.target. Feb 20 19:05:43 np0005625471.novalocal systemd[1]: Starting OpenSSH server daemon... Feb 20 19:05:43 np0005625471.novalocal sshd[45645]: Server listening on 0.0.0.0 port 22. Feb 20 19:05:43 np0005625471.novalocal sshd[45645]: Server listening on :: port 22. Feb 20 19:05:43 np0005625471.novalocal systemd[1]: Started OpenSSH server daemon. Feb 20 19:05:44 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:05:44 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:05:45 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:05:45 np0005625471.novalocal systemd-rc-local-generator[45736]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:05:45 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:05:49 np0005625471.novalocal sudo[28389]: pam_unix(sudo:session): session closed for user root Feb 20 19:05:49 np0005625471.novalocal sudo[50915]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jrndqfcmnahxrynwevosenqtyaypsixl ; /usr/bin/python3' Feb 20 19:05:49 np0005625471.novalocal sudo[50915]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:05:49 np0005625471.novalocal python3[50935]: ansible-dnf Invoked with name=['net-tools', 'lsof', 'sysstat', 'psmisc', 'dnf-utils'] state=present allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Feb 20 19:05:51 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:05:51 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:05:51 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Consumed 8.737s CPU time. Feb 20 19:05:51 np0005625471.novalocal systemd[1]: run-r88d05a0df11d46a786b03c775ab5ba98.service: Deactivated successfully. Feb 20 19:05:52 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:05:52 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:05:52 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:05:53 np0005625471.novalocal systemd-rc-local-generator[53890]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:05:53 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:05:53 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:05:53 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:05:53 np0005625471.novalocal systemd[1]: run-rc9c2011adce34ba29403fd625dcd4e47.service: Deactivated successfully. Feb 20 19:05:53 np0005625471.novalocal sudo[50915]: pam_unix(sudo:session): session closed for user root Feb 20 19:05:53 np0005625471.novalocal sudo[54302]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yyythwsivflhpoyzzmifmveliohtrmuu ; /usr/bin/python3' Feb 20 19:05:53 np0005625471.novalocal sudo[54302]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:05:53 np0005625471.novalocal python3[54304]: ansible-replace Invoked with dest=/usr/lib/systemd/system/sysstat-collect.timer regexp=10 replace=1 path=/usr/lib/systemd/system/sysstat-collect.timer backup=False encoding=utf-8 follow=False unsafe_writes=False after=None before=None validate=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None src=None force=None content=NOT_LOGGING_PARAMETER remote_src=None delimiter=None directory_mode=None Feb 20 19:05:54 np0005625471.novalocal sudo[54302]: pam_unix(sudo:session): session closed for user root Feb 20 19:05:54 np0005625471.novalocal sudo[54311]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rmgffyvdpgfuxvvxjoltdrdfucnburet ; /usr/bin/python3' Feb 20 19:05:54 np0005625471.novalocal sudo[54311]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:05:54 np0005625471.novalocal python3[54313]: ansible-systemd Invoked with name=sysstat enabled=True daemon_reload=True state=started daemon_reexec=False no_block=False force=None masked=None user=None scope=None Feb 20 19:05:54 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:05:54 np0005625471.novalocal systemd-rc-local-generator[54335]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:05:54 np0005625471.novalocal systemd[1]: Started Run system activity accounting tool every 1 minutes. Feb 20 19:05:54 np0005625471.novalocal systemd[1]: Started Generate summary of yesterday's process accounting. Feb 20 19:05:54 np0005625471.novalocal systemd[1]: Starting Resets System Activity Logs... Feb 20 19:05:54 np0005625471.novalocal systemd[1]: Finished Resets System Activity Logs. Feb 20 19:05:54 np0005625471.novalocal sudo[54311]: pam_unix(sudo:session): session closed for user root Feb 20 19:05:54 np0005625471.novalocal sudo[54367]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ztmgfchgfgakyapvpxxzzeoygpwuueaw ; /usr/bin/python3' Feb 20 19:05:54 np0005625471.novalocal sudo[54367]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:05:54 np0005625471.novalocal python3[54369]: ansible-lineinfile Invoked with dest=/etc/hosts line=127.0.0.1 np0005625471 np0005625471.novalocal state=present path=/etc/hosts backrefs=False create=False backup=False firstmatch=False follow=False unsafe_writes=False regexp=None insertafter=None insertbefore=None validate=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None src=None force=None content=NOT_LOGGING_PARAMETER remote_src=None delimiter=None directory_mode=None Feb 20 19:05:54 np0005625471.novalocal sudo[54367]: pam_unix(sudo:session): session closed for user root Feb 20 19:05:55 np0005625471.novalocal sudo[54383]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nazwaxlcuqygzlwyymfcrpaalguzeofq ; /usr/bin/python3' Feb 20 19:05:55 np0005625471.novalocal sudo[54383]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:05:55 np0005625471.novalocal python3[54385]: ansible-dnf Invoked with name=['qemu-kvm'] state=present allow_downgrade=False autoremove=False bugfix=False disable_gpg_check=False disable_plugin=[] disablerepo=[] download_only=False enable_plugin=[] enablerepo=[] exclude=[] installroot=/ install_repoquery=True install_weak_deps=True security=False skip_broken=False update_cache=False update_only=False validate_certs=True lock_timeout=30 conf_file=None disable_excludes=None download_dir=None list=None releasever=None Feb 20 19:06:00 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:06:00 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:06:00 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:06:00 np0005625471.novalocal groupadd[54431]: group added to /etc/group: name=qemu, GID=107 Feb 20 19:06:00 np0005625471.novalocal groupadd[54431]: group added to /etc/gshadow: name=qemu Feb 20 19:06:00 np0005625471.novalocal groupadd[54431]: new group: name=qemu, GID=107 Feb 20 19:06:00 np0005625471.novalocal useradd[54438]: new user: name=qemu, UID=107, GID=107, home=/, shell=/sbin/nologin, from=none Feb 20 19:06:00 np0005625471.novalocal useradd[54438]: add 'qemu' to group 'kvm' Feb 20 19:06:00 np0005625471.novalocal useradd[54438]: add 'qemu' to shadow group 'kvm' Feb 20 19:06:01 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:06:01 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:06:01 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:06:01 np0005625471.novalocal systemd-rc-local-generator[54475]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:06:01 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:06:02 np0005625471.novalocal sudo[54383]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:02 np0005625471.novalocal sudo[56067]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ysfubkrxajymgzwxcdaejouuuottpwpa ; /usr/bin/python3' Feb 20 19:06:02 np0005625471.novalocal sudo[56067]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:02 np0005625471.novalocal python3[56097]: ansible-command Invoked with _raw_params=awk -F: '/^flags/ {print $2; exit}' /proc/cpuinfo warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:06:03 np0005625471.novalocal sudo[56067]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:03 np0005625471.novalocal sudo[56901]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nlpisbstxpmznnybtnapwrpomysucoqo ; /usr/bin/python3' Feb 20 19:06:03 np0005625471.novalocal sudo[56901]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:03 np0005625471.novalocal python3[56923]: ansible-modprobe Invoked with name=kvm_amd state=absent params= Feb 20 19:06:03 np0005625471.novalocal sudo[56901]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:03 np0005625471.novalocal sudo[57410]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-esnmstridlinzbjetunmmugthnlavvga ; /usr/bin/python3' Feb 20 19:06:03 np0005625471.novalocal sudo[57410]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:03 np0005625471.novalocal python3[57441]: ansible-stat Invoked with path=/etc/modprobe.d/kvm_amd.conf follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Feb 20 19:06:03 np0005625471.novalocal sudo[57410]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:04 np0005625471.novalocal sudo[57728]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sptddsyvjbpdqtuykoxwilranbjfablt ; /usr/bin/python3' Feb 20 19:06:04 np0005625471.novalocal sudo[57728]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:04 np0005625471.novalocal python3[57742]: ansible-copy Invoked with dest=/etc/modprobe.d/kvm_amd.conf src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1771632363.6815944-57231-110174517417335/source _original_basename=tmpcofbbp8z follow=False checksum=e2547a33b0a5554e43a0b5a03b31b3e9119f68b3 backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None regexp=None delimiter=None Feb 20 19:06:04 np0005625471.novalocal sudo[57728]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:04 np0005625471.novalocal sudo[57835]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jbvgixtaturzztivnfcdkagirulxwmnx ; /usr/bin/python3' Feb 20 19:06:04 np0005625471.novalocal sudo[57835]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:04 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:06:04 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:06:04 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Consumed 3.354s CPU time. Feb 20 19:06:04 np0005625471.novalocal systemd[1]: run-rc2b055096c6d4f76af3b4f8616d4b112.service: Deactivated successfully. Feb 20 19:06:04 np0005625471.novalocal python3[57837]: ansible-modprobe Invoked with name=kvm_amd state=present params= Feb 20 19:06:04 np0005625471.novalocal kernel: kvm_amd: TSC scaling supported Feb 20 19:06:04 np0005625471.novalocal kernel: kvm_amd: Nested Virtualization enabled Feb 20 19:06:04 np0005625471.novalocal kernel: kvm_amd: Nested Paging enabled Feb 20 19:06:04 np0005625471.novalocal kernel: kvm_amd: LBR virtualization supported Feb 20 19:06:04 np0005625471.novalocal sudo[57835]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:04 np0005625471.novalocal sudo[57847]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tswvqtfstdkwvnegixfxoagqegqarwcv ; /usr/bin/python3' Feb 20 19:06:04 np0005625471.novalocal sudo[57847]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:04 np0005625471.novalocal python3[57849]: ansible-command Invoked with _raw_params=cat /sys/module/kvm_amd/parameters/nested warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None creates=None removes=None stdin=None Feb 20 19:06:04 np0005625471.novalocal sudo[57847]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:05 np0005625471.novalocal sudo[57877]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jzthbwybpvrwveoxsnmrzvtlktqinaar ; /usr/bin/python3' Feb 20 19:06:05 np0005625471.novalocal sudo[57877]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:05 np0005625471.novalocal python3[57879]: ansible-file Invoked with path=/var/log/weirdo-project state=directory recurse=True force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None content=NOT_LOGGING_PARAMETER backup=None remote_src=None regexp=None delimiter=None directory_mode=None Feb 20 19:06:05 np0005625471.novalocal sudo[57877]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:05 np0005625471.novalocal sudo[57886]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tpbzytxwzpxyzjxukafyvzvywzeozalr ; /usr/bin/python3' Feb 20 19:06:05 np0005625471.novalocal sudo[57886]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:05 np0005625471.novalocal python3[57888]: ansible-git Invoked with repo=https://review.opendev.org/x/packstack dest=/tmp/packstack version=unmaintained/2023.1 force=True remote=origin clone=True update=True verify_commit=False gpg_whitelist=[] accept_hostkey=False bare=False recursive=True track_submodules=False refspec=None reference=None depth=None key_file=None ssh_opts=None executable=None umask=None archive=None separate_git_dir=None Feb 20 19:06:06 np0005625471.novalocal sudo[57886]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:06 np0005625471.novalocal sudo[57913]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cdsrzyaucttwhmoixkymofmzhqtbycsc ; /usr/bin/python3' Feb 20 19:06:06 np0005625471.novalocal sudo[57913]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:07 np0005625471.novalocal python3[57915]: ansible-git Invoked with repo=https://review.opendev.org/x/packstack dest=/tmp/packstack version=master force=True remote=origin clone=True update=True verify_commit=False gpg_whitelist=[] accept_hostkey=False bare=False recursive=True track_submodules=False refspec=None reference=None depth=None key_file=None ssh_opts=None executable=None umask=None archive=None separate_git_dir=None Feb 20 19:06:07 np0005625471.novalocal sudo[57913]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:07 np0005625471.novalocal sudo[57948]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mrhgbdjdghdifnfacotxfsxbaijfdlnp ; /usr/bin/python3' Feb 20 19:06:07 np0005625471.novalocal sudo[57948]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:07 np0005625471.novalocal python3[57950]: ansible-file Invoked with state=directory path=/etc/puppetlabs/facter recurse=False force=False follow=True modification_time_format=%Y%m%d%H%M.%S access_time_format=%Y%m%d%H%M.%S unsafe_writes=False _original_basename=None _diff_peek=None src=None modification_time=None access_time=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None content=NOT_LOGGING_PARAMETER backup=None remote_src=None regexp=None delimiter=None directory_mode=None Feb 20 19:06:07 np0005625471.novalocal sudo[57948]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:07 np0005625471.novalocal sudo[57965]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qlsjtetgqigmkxiqwkxrxurfdbfzpdtv ; /usr/bin/python3' Feb 20 19:06:07 np0005625471.novalocal sudo[57965]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:07 np0005625471.novalocal python3[57967]: ansible-stat Invoked with path=/etc/puppetlabs/facter/facter.conf follow=False get_checksum=True checksum_algorithm=sha1 get_md5=False get_mime=True get_attributes=True Feb 20 19:06:07 np0005625471.novalocal sudo[57965]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:07 np0005625471.novalocal sudo[57971]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wuzccoldzbuaypejsztqpwomsatizcjv ; /usr/bin/python3' Feb 20 19:06:07 np0005625471.novalocal sudo[57971]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:08 np0005625471.novalocal python3[57973]: ansible-copy Invoked with dest=/etc/puppetlabs/facter/facter.conf src=/home/zuul-worker/.ansible/tmp/ansible-tmp-1771632367.7225842-57955-113863079632163/source _original_basename=tmpqkuh3dn9 follow=False checksum=03c8891a858c55adad53c14144e66c0e880eaadb backup=False force=True unsafe_writes=False content=NOT_LOGGING_PARAMETER validate=None directory_mode=None remote_src=None local_follow=None mode=None owner=None group=None seuser=None serole=None selevel=None setype=None attributes=None regexp=None delimiter=None Feb 20 19:06:08 np0005625471.novalocal sudo[57971]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:08 np0005625471.novalocal sudo[57982]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gfxfwppfkhfdmjfmazauoaocwcwjpyfn ; WORKSPACE=/var/log/weirdo-project MANAGE_REPOS=false INSTALL_FROM_SOURCE=false ADDITIONAL_ARGS=\' --nova-libvirt-virt-type=kvm \' SCENARIO=scenario002 SELINUX_ENFORCING=false /usr/bin/python3' Feb 20 19:06:08 np0005625471.novalocal sudo[57982]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:06:08 np0005625471.novalocal python3[57984]: ansible-command Invoked with chdir=/tmp/packstack _raw_params=./run_tests.sh warn=True _uses_shell=False stdin_add_newline=True strip_empty_ends=True argv=None executable=None creates=None removes=None stdin=None Feb 20 19:06:08 np0005625471.novalocal sudo[57987]: root : PWD=/tmp/packstack ; USER=root ; COMMAND=/bin/touch /etc/fixed_disk_layout Feb 20 19:06:08 np0005625471.novalocal sudo[57987]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:06:08 np0005625471.novalocal sudo[57987]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:08 np0005625471.novalocal sudo[57995]: root : PWD=/tmp/packstack ; USER=root ; COMMAND=/bin/dd if=/dev/zero of=/root/swapfile bs=1M count=8192 Feb 20 19:06:08 np0005625471.novalocal sudo[57995]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:06:26 np0005625471.novalocal sudo[57995]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:26 np0005625471.novalocal sudo[57999]: root : PWD=/tmp/packstack ; USER=root ; COMMAND=/bin/chmod 600 /root/swapfile Feb 20 19:06:26 np0005625471.novalocal sudo[57999]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:06:26 np0005625471.novalocal sudo[57999]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:26 np0005625471.novalocal sudo[58002]: root : PWD=/tmp/packstack ; USER=root ; COMMAND=/sbin/mkswap /root/swapfile Feb 20 19:06:26 np0005625471.novalocal sudo[58002]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:06:33 np0005625471.novalocal sudo[58002]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:33 np0005625471.novalocal sudo[58007]: root : PWD=/tmp/packstack ; USER=root ; COMMAND=/sbin/swapon /root/swapfile Feb 20 19:06:33 np0005625471.novalocal sudo[58007]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:06:33 np0005625471.novalocal kernel: Adding 8388604k swap on /root/swapfile. Priority:-2 extents:25 across:9191892k Feb 20 19:06:33 np0005625471.novalocal systemd[4488]: Created slice User Background Tasks Slice. Feb 20 19:06:33 np0005625471.novalocal sudo[58007]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:33 np0005625471.novalocal systemd[4488]: Starting Cleanup of User's Temporary Files and Directories... Feb 20 19:06:33 np0005625471.novalocal sudo[58012]: root : PWD=/tmp/packstack ; USER=root ; COMMAND=/sbin/sysctl vm Feb 20 19:06:34 np0005625471.novalocal sudo[58012]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:06:34 np0005625471.novalocal sudo[58012]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:34 np0005625471.novalocal systemd[4488]: Finished Cleanup of User's Temporary Files and Directories. Feb 20 19:06:34 np0005625471.novalocal sudo[58015]: root : PWD=/tmp/packstack ; USER=root ; COMMAND=/bin/sed -i /vm.swappiness/d /etc/sysctl.conf Feb 20 19:06:34 np0005625471.novalocal sudo[58015]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:06:34 np0005625471.novalocal sudo[58015]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:34 np0005625471.novalocal sudo[58018]: root : PWD=/tmp/packstack ; USER=root ; COMMAND=/sbin/sysctl -w vm.swappiness=10 Feb 20 19:06:34 np0005625471.novalocal sudo[58018]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:06:34 np0005625471.novalocal sudo[58018]: pam_unix(sudo:session): session closed for user root Feb 20 19:06:38 np0005625471.novalocal dbus-broker-launch[823]: avc: op=setenforce lsm=selinux enforcing=0 res=1 Feb 20 19:06:49 np0005625471.novalocal kernel: SELinux: Converting 471 SID table entries... Feb 20 19:06:49 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:06:49 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:06:49 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:06:49 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:06:49 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:06:49 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:06:49 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:06:50 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=3 res=1 Feb 20 19:06:50 np0005625471.novalocal systemd[1]: Starting PCP Reboot Initialization Helper Service... Feb 20 19:06:50 np0005625471.novalocal systemd[1]: Finished PCP Reboot Initialization Helper Service. Feb 20 19:06:50 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:06:51 np0005625471.novalocal systemd-rc-local-generator[58571]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:06:52 np0005625471.novalocal setsebool[58755]: The virt_use_nfs policy boolean was changed to 1 by root Feb 20 19:06:52 np0005625471.novalocal setsebool[58755]: The virt_sandbox_use_all_caps policy boolean was changed to 1 by root Feb 20 19:07:02 np0005625471.novalocal kernel: SELinux: Converting 485 SID table entries... Feb 20 19:07:02 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:07:02 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:07:02 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:07:02 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:07:02 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:07:02 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:07:02 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:07:03 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=5 res=1 Feb 20 19:07:03 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:07:03 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:07:03 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:07:03 np0005625471.novalocal groupadd[58775]: group added to /etc/group: name=puppet, GID=52 Feb 20 19:07:04 np0005625471.novalocal groupadd[58775]: group added to /etc/gshadow: name=puppet Feb 20 19:07:04 np0005625471.novalocal groupadd[58775]: new group: name=puppet, GID=52 Feb 20 19:07:04 np0005625471.novalocal useradd[58782]: new user: name=puppet, UID=52, GID=52, home=/var/lib/puppet, shell=/sbin/nologin, from=none Feb 20 19:08:01 np0005625471.novalocal kernel: SELinux: Converting 2738 SID table entries... Feb 20 19:08:01 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:08:01 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:08:01 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:08:01 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:08:01 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:08:01 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:08:01 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:08:32 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=7 res=1 Feb 20 19:08:32 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:08:32 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:08:32 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:08:32 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:08:32 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:08:32 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:08:32 np0005625471.novalocal systemd-rc-local-generator[59776]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:08:32 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:08:33 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:08:33 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:08:33 np0005625471.novalocal systemd[1]: run-r8f6af45d65754f5cb4ba1b493631f029.service: Deactivated successfully. Feb 20 19:08:38 np0005625471.novalocal su[59988]: (to root) root on none Feb 20 19:08:38 np0005625471.novalocal su[59988]: pam_unix(su:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:08:38 np0005625471.novalocal su[59988]: pam_unix(su:session): session closed for user root Feb 20 19:08:38 np0005625471.novalocal su[59991]: (to root) root on none Feb 20 19:08:38 np0005625471.novalocal su[59991]: pam_unix(su:session): session opened for user root(uid=0) by zuul-worker(uid=0) Feb 20 19:08:38 np0005625471.novalocal su[59991]: pam_unix(su:session): session closed for user root Feb 20 19:08:54 np0005625471.novalocal sshd-session[60079]: Connection closed by 38.102.83.198 port 41620 Feb 20 19:08:54 np0005625471.novalocal sshd-session[60089]: Accepted publickey for root from 38.102.83.198 port 41628 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:08:54 np0005625471.novalocal systemd[1]: Created slice User Slice of UID 0. Feb 20 19:08:54 np0005625471.novalocal systemd[1]: Starting User Runtime Directory /run/user/0... Feb 20 19:08:54 np0005625471.novalocal systemd-logind[833]: New session 4 of user root. Feb 20 19:08:54 np0005625471.novalocal systemd[1]: Finished User Runtime Directory /run/user/0. Feb 20 19:08:54 np0005625471.novalocal systemd[1]: Starting User Manager for UID 0... Feb 20 19:08:54 np0005625471.novalocal systemd[60093]: pam_unix(systemd-user:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Queued start job for default target Main User Target. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Created slice User Application Slice. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Mark boot as successful after the user session has run 2 minutes was skipped because of an unmet condition check (ConditionUser=!@system). Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Started Daily Cleanup of User's Temporary Directories. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Reached target Paths. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Reached target Timers. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Starting D-Bus User Message Bus Socket... Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: PipeWire PulseAudio was skipped because of an unmet condition check (ConditionUser=!root). Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: PipeWire Multimedia System Sockets was skipped because of an unmet condition check (ConditionUser=!root). Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Starting Create User's Volatile Files and Directories... Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Listening on D-Bus User Message Bus Socket. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Reached target Sockets. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Finished Create User's Volatile Files and Directories. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Reached target Basic System. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Reached target Main User Target. Feb 20 19:08:55 np0005625471.novalocal systemd[60093]: Startup finished in 218ms. Feb 20 19:08:55 np0005625471.novalocal systemd[1]: Started User Manager for UID 0. Feb 20 19:08:55 np0005625471.novalocal systemd[1]: Started Session 4 of User root. Feb 20 19:08:55 np0005625471.novalocal sshd-session[60089]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:08:55 np0005625471.novalocal sshd-session[60104]: Received disconnect from 38.102.83.198 port 41628:11: disconnected by user Feb 20 19:08:55 np0005625471.novalocal sshd-session[60104]: Disconnected from user root 38.102.83.198 port 41628 Feb 20 19:08:55 np0005625471.novalocal sshd-session[60089]: pam_unix(sshd:session): session closed for user root Feb 20 19:08:55 np0005625471.novalocal systemd[1]: session-4.scope: Deactivated successfully. Feb 20 19:08:55 np0005625471.novalocal systemd-logind[833]: Session 4 logged out. Waiting for processes to exit. Feb 20 19:08:55 np0005625471.novalocal systemd-logind[833]: Removed session 4. Feb 20 19:08:55 np0005625471.novalocal sshd-session[60137]: Accepted publickey for root from 38.102.83.198 port 41638 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:08:55 np0005625471.novalocal systemd-logind[833]: New session 6 of user root. Feb 20 19:08:55 np0005625471.novalocal systemd[1]: Started Session 6 of User root. Feb 20 19:08:55 np0005625471.novalocal sshd-session[60137]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:08:55 np0005625471.novalocal sshd-session[60140]: Received disconnect from 38.102.83.198 port 41638:11: disconnected by user Feb 20 19:08:55 np0005625471.novalocal sshd-session[60140]: Disconnected from user root 38.102.83.198 port 41638 Feb 20 19:08:55 np0005625471.novalocal sshd-session[60137]: pam_unix(sshd:session): session closed for user root Feb 20 19:08:55 np0005625471.novalocal systemd-logind[833]: Session 6 logged out. Waiting for processes to exit. Feb 20 19:08:55 np0005625471.novalocal systemd[1]: session-6.scope: Deactivated successfully. Feb 20 19:08:55 np0005625471.novalocal systemd-logind[833]: Removed session 6. Feb 20 19:08:55 np0005625471.novalocal sshd-session[60172]: Accepted publickey for root from 38.102.83.198 port 41654 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:08:55 np0005625471.novalocal systemd-logind[833]: New session 7 of user root. Feb 20 19:08:55 np0005625471.novalocal systemd[1]: Started Session 7 of User root. Feb 20 19:08:55 np0005625471.novalocal sshd-session[60172]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:08:56 np0005625471.novalocal sshd-session[60175]: Received disconnect from 38.102.83.198 port 41654:11: disconnected by user Feb 20 19:08:56 np0005625471.novalocal sshd-session[60175]: Disconnected from user root 38.102.83.198 port 41654 Feb 20 19:08:56 np0005625471.novalocal sshd-session[60172]: pam_unix(sshd:session): session closed for user root Feb 20 19:08:56 np0005625471.novalocal systemd-logind[833]: Session 7 logged out. Waiting for processes to exit. Feb 20 19:08:56 np0005625471.novalocal systemd[1]: session-7.scope: Deactivated successfully. Feb 20 19:08:56 np0005625471.novalocal systemd-logind[833]: Removed session 7. Feb 20 19:08:56 np0005625471.novalocal sshd-session[60206]: Accepted publickey for root from 38.102.83.198 port 41670 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:08:56 np0005625471.novalocal systemd-logind[833]: New session 8 of user root. Feb 20 19:08:56 np0005625471.novalocal systemd[1]: Started Session 8 of User root. Feb 20 19:08:56 np0005625471.novalocal sshd-session[60206]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:21 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:09:21 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:09:21 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:09:22 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:09:22 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:09:23 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:09:23 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:09:23 np0005625471.novalocal systemd[1]: run-r8fa27465cdd94a8fbf360963d35e2f65.service: Deactivated successfully. Feb 20 19:09:24 np0005625471.novalocal sshd-session[60209]: Received disconnect from 38.102.83.198 port 41670:11: disconnected by user Feb 20 19:09:24 np0005625471.novalocal sshd-session[60209]: Disconnected from user root 38.102.83.198 port 41670 Feb 20 19:09:24 np0005625471.novalocal sshd-session[60206]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:24 np0005625471.novalocal systemd[1]: session-8.scope: Deactivated successfully. Feb 20 19:09:24 np0005625471.novalocal systemd[1]: session-8.scope: Consumed 22.988s CPU time. Feb 20 19:09:24 np0005625471.novalocal systemd-logind[833]: Session 8 logged out. Waiting for processes to exit. Feb 20 19:09:24 np0005625471.novalocal systemd-logind[833]: Removed session 8. Feb 20 19:09:24 np0005625471.novalocal sshd-session[60432]: Accepted publickey for root from 38.102.83.198 port 34392 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:24 np0005625471.novalocal systemd-logind[833]: New session 9 of user root. Feb 20 19:09:24 np0005625471.novalocal systemd[1]: Started Session 9 of User root. Feb 20 19:09:24 np0005625471.novalocal sshd-session[60432]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:24 np0005625471.novalocal sshd-session[60436]: Received disconnect from 38.102.83.198 port 34392:11: disconnected by user Feb 20 19:09:24 np0005625471.novalocal sshd-session[60436]: Disconnected from user root 38.102.83.198 port 34392 Feb 20 19:09:24 np0005625471.novalocal sshd-session[60432]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:24 np0005625471.novalocal systemd[1]: session-9.scope: Deactivated successfully. Feb 20 19:09:24 np0005625471.novalocal systemd-logind[833]: Session 9 logged out. Waiting for processes to exit. Feb 20 19:09:24 np0005625471.novalocal systemd-logind[833]: Removed session 9. Feb 20 19:09:24 np0005625471.novalocal sshd-session[60469]: Accepted publickey for root from 38.102.83.198 port 34406 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:24 np0005625471.novalocal systemd-logind[833]: New session 10 of user root. Feb 20 19:09:24 np0005625471.novalocal systemd[1]: Started Session 10 of User root. Feb 20 19:09:24 np0005625471.novalocal sshd-session[60469]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:27 np0005625471.novalocal sshd-session[60472]: Received disconnect from 38.102.83.198 port 34406:11: disconnected by user Feb 20 19:09:27 np0005625471.novalocal sshd-session[60472]: Disconnected from user root 38.102.83.198 port 34406 Feb 20 19:09:27 np0005625471.novalocal sshd-session[60469]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:27 np0005625471.novalocal systemd[1]: session-10.scope: Deactivated successfully. Feb 20 19:09:27 np0005625471.novalocal systemd[1]: session-10.scope: Consumed 2.536s CPU time. Feb 20 19:09:27 np0005625471.novalocal systemd-logind[833]: Session 10 logged out. Waiting for processes to exit. Feb 20 19:09:27 np0005625471.novalocal systemd-logind[833]: Removed session 10. Feb 20 19:09:27 np0005625471.novalocal sshd-session[60601]: Accepted publickey for root from 38.102.83.198 port 34410 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:27 np0005625471.novalocal systemd-logind[833]: New session 11 of user root. Feb 20 19:09:27 np0005625471.novalocal systemd[1]: Started Session 11 of User root. Feb 20 19:09:27 np0005625471.novalocal sshd-session[60601]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:28 np0005625471.novalocal sshd-session[60604]: Received disconnect from 38.102.83.198 port 34410:11: disconnected by user Feb 20 19:09:28 np0005625471.novalocal sshd-session[60604]: Disconnected from user root 38.102.83.198 port 34410 Feb 20 19:09:28 np0005625471.novalocal sshd-session[60601]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:28 np0005625471.novalocal systemd[1]: session-11.scope: Deactivated successfully. Feb 20 19:09:28 np0005625471.novalocal systemd-logind[833]: Session 11 logged out. Waiting for processes to exit. Feb 20 19:09:28 np0005625471.novalocal systemd-logind[833]: Removed session 11. Feb 20 19:09:28 np0005625471.novalocal sshd-session[60639]: Connection closed by 38.102.83.198 port 34416 [preauth] Feb 20 19:09:28 np0005625471.novalocal sshd-session[60640]: Connection closed by 38.102.83.198 port 34428 [preauth] Feb 20 19:09:28 np0005625471.novalocal sshd-session[60641]: Unable to negotiate with 38.102.83.198 port 34434: no matching host key type found. Their offer: ssh-ed25519 [preauth] Feb 20 19:09:28 np0005625471.novalocal sshd-session[60642]: Unable to negotiate with 38.102.83.198 port 34436: no matching host key type found. Their offer: sk-ecdsa-sha2-nistp256@openssh.com [preauth] Feb 20 19:09:28 np0005625471.novalocal sshd-session[60643]: Unable to negotiate with 38.102.83.198 port 34452: no matching host key type found. Their offer: sk-ssh-ed25519@openssh.com [preauth] Feb 20 19:09:29 np0005625471.novalocal sshd-session[60650]: Accepted publickey for root from 38.102.83.198 port 34454 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: New session 12 of user root. Feb 20 19:09:29 np0005625471.novalocal systemd[1]: Started Session 12 of User root. Feb 20 19:09:29 np0005625471.novalocal sshd-session[60650]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:29 np0005625471.novalocal sshd-session[60653]: Received disconnect from 38.102.83.198 port 34454:11: disconnected by user Feb 20 19:09:29 np0005625471.novalocal sshd-session[60653]: Disconnected from user root 38.102.83.198 port 34454 Feb 20 19:09:29 np0005625471.novalocal sshd-session[60650]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: Session 12 logged out. Waiting for processes to exit. Feb 20 19:09:29 np0005625471.novalocal systemd[1]: session-12.scope: Deactivated successfully. Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: Removed session 12. Feb 20 19:09:29 np0005625471.novalocal sshd-session[60683]: Accepted publickey for root from 38.102.83.198 port 45326 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: New session 13 of user root. Feb 20 19:09:29 np0005625471.novalocal systemd[1]: Started Session 13 of User root. Feb 20 19:09:29 np0005625471.novalocal sshd-session[60683]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:29 np0005625471.novalocal sshd-session[60686]: Received disconnect from 38.102.83.198 port 45326:11: disconnected by user Feb 20 19:09:29 np0005625471.novalocal sshd-session[60686]: Disconnected from user root 38.102.83.198 port 45326 Feb 20 19:09:29 np0005625471.novalocal sshd-session[60683]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:29 np0005625471.novalocal systemd[1]: session-13.scope: Deactivated successfully. Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: Session 13 logged out. Waiting for processes to exit. Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: Removed session 13. Feb 20 19:09:29 np0005625471.novalocal sshd-session[60716]: Accepted publickey for root from 38.102.83.198 port 45330 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: New session 14 of user root. Feb 20 19:09:29 np0005625471.novalocal systemd[1]: Started Session 14 of User root. Feb 20 19:09:29 np0005625471.novalocal sshd-session[60716]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:29 np0005625471.novalocal sshd-session[60719]: Received disconnect from 38.102.83.198 port 45330:11: disconnected by user Feb 20 19:09:29 np0005625471.novalocal sshd-session[60719]: Disconnected from user root 38.102.83.198 port 45330 Feb 20 19:09:29 np0005625471.novalocal sshd-session[60716]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:29 np0005625471.novalocal systemd[1]: session-14.scope: Deactivated successfully. Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: Session 14 logged out. Waiting for processes to exit. Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: Removed session 14. Feb 20 19:09:29 np0005625471.novalocal sshd-session[60749]: Accepted publickey for root from 38.102.83.198 port 45336 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: New session 15 of user root. Feb 20 19:09:29 np0005625471.novalocal systemd[1]: Started Session 15 of User root. Feb 20 19:09:29 np0005625471.novalocal sshd-session[60749]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:29 np0005625471.novalocal sshd-session[60752]: Received disconnect from 38.102.83.198 port 45336:11: disconnected by user Feb 20 19:09:29 np0005625471.novalocal sshd-session[60752]: Disconnected from user root 38.102.83.198 port 45336 Feb 20 19:09:29 np0005625471.novalocal sshd-session[60749]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: Session 15 logged out. Waiting for processes to exit. Feb 20 19:09:29 np0005625471.novalocal systemd[1]: session-15.scope: Deactivated successfully. Feb 20 19:09:29 np0005625471.novalocal systemd-logind[833]: Removed session 15. Feb 20 19:09:30 np0005625471.novalocal sshd-session[60784]: Accepted publickey for root from 38.102.83.198 port 45342 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:30 np0005625471.novalocal systemd-logind[833]: New session 16 of user root. Feb 20 19:09:30 np0005625471.novalocal systemd[1]: Started Session 16 of User root. Feb 20 19:09:30 np0005625471.novalocal sshd-session[60784]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:30 np0005625471.novalocal sshd-session[60787]: Received disconnect from 38.102.83.198 port 45342:11: disconnected by user Feb 20 19:09:30 np0005625471.novalocal sshd-session[60787]: Disconnected from user root 38.102.83.198 port 45342 Feb 20 19:09:30 np0005625471.novalocal sshd-session[60784]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:30 np0005625471.novalocal systemd[1]: session-16.scope: Deactivated successfully. Feb 20 19:09:30 np0005625471.novalocal systemd-logind[833]: Session 16 logged out. Waiting for processes to exit. Feb 20 19:09:30 np0005625471.novalocal systemd-logind[833]: Removed session 16. Feb 20 19:09:30 np0005625471.novalocal sshd-session[60820]: Accepted publickey for root from 38.102.83.198 port 45358 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:30 np0005625471.novalocal systemd-logind[833]: New session 17 of user root. Feb 20 19:09:30 np0005625471.novalocal systemd[1]: Started Session 17 of User root. Feb 20 19:09:30 np0005625471.novalocal sshd-session[60820]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:30 np0005625471.novalocal sshd-session[60823]: Received disconnect from 38.102.83.198 port 45358:11: disconnected by user Feb 20 19:09:30 np0005625471.novalocal sshd-session[60823]: Disconnected from user root 38.102.83.198 port 45358 Feb 20 19:09:30 np0005625471.novalocal sshd-session[60820]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:30 np0005625471.novalocal systemd[1]: session-17.scope: Deactivated successfully. Feb 20 19:09:30 np0005625471.novalocal systemd-logind[833]: Session 17 logged out. Waiting for processes to exit. Feb 20 19:09:30 np0005625471.novalocal systemd-logind[833]: Removed session 17. Feb 20 19:09:30 np0005625471.novalocal sshd-session[60856]: Accepted publickey for root from 38.102.83.198 port 45362 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:30 np0005625471.novalocal systemd-logind[833]: New session 18 of user root. Feb 20 19:09:30 np0005625471.novalocal systemd[1]: Started Session 18 of User root. Feb 20 19:09:30 np0005625471.novalocal sshd-session[60856]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:31 np0005625471.novalocal sshd-session[60859]: Received disconnect from 38.102.83.198 port 45362:11: disconnected by user Feb 20 19:09:31 np0005625471.novalocal sshd-session[60859]: Disconnected from user root 38.102.83.198 port 45362 Feb 20 19:09:31 np0005625471.novalocal sshd-session[60856]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:31 np0005625471.novalocal systemd[1]: session-18.scope: Deactivated successfully. Feb 20 19:09:31 np0005625471.novalocal systemd-logind[833]: Session 18 logged out. Waiting for processes to exit. Feb 20 19:09:31 np0005625471.novalocal systemd-logind[833]: Removed session 18. Feb 20 19:09:31 np0005625471.novalocal sshd-session[60890]: Accepted publickey for root from 38.102.83.198 port 45364 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:31 np0005625471.novalocal systemd-logind[833]: New session 19 of user root. Feb 20 19:09:31 np0005625471.novalocal systemd[1]: Started Session 19 of User root. Feb 20 19:09:31 np0005625471.novalocal sshd-session[60890]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:31 np0005625471.novalocal sshd-session[60893]: Received disconnect from 38.102.83.198 port 45364:11: disconnected by user Feb 20 19:09:31 np0005625471.novalocal sshd-session[60893]: Disconnected from user root 38.102.83.198 port 45364 Feb 20 19:09:31 np0005625471.novalocal sshd-session[60890]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:31 np0005625471.novalocal systemd-logind[833]: Session 19 logged out. Waiting for processes to exit. Feb 20 19:09:31 np0005625471.novalocal sshd-session[60929]: Accepted publickey for root from 38.102.83.198 port 45380 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:31 np0005625471.novalocal systemd-logind[833]: New session 20 of user root. Feb 20 19:09:31 np0005625471.novalocal systemd[1]: Started Session 20 of User root. Feb 20 19:09:31 np0005625471.novalocal sshd-session[60929]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:31 np0005625471.novalocal sshd-session[60932]: Received disconnect from 38.102.83.198 port 45380:11: disconnected by user Feb 20 19:09:31 np0005625471.novalocal sshd-session[60932]: Disconnected from user root 38.102.83.198 port 45380 Feb 20 19:09:31 np0005625471.novalocal sshd-session[60929]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:31 np0005625471.novalocal systemd[1]: session-20.scope: Deactivated successfully. Feb 20 19:09:31 np0005625471.novalocal systemd-logind[833]: Session 20 logged out. Waiting for processes to exit. Feb 20 19:09:31 np0005625471.novalocal systemd-logind[833]: Removed session 20. Feb 20 19:09:34 np0005625471.novalocal sshd-session[61064]: Accepted publickey for root from 38.102.83.198 port 45394 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:34 np0005625471.novalocal systemd-logind[833]: New session 21 of user root. Feb 20 19:09:34 np0005625471.novalocal systemd[1]: Started Session 21 of User root. Feb 20 19:09:34 np0005625471.novalocal sshd-session[61064]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:34 np0005625471.novalocal sshd-session[61067]: Received disconnect from 38.102.83.198 port 45394:11: disconnected by user Feb 20 19:09:34 np0005625471.novalocal sshd-session[61067]: Disconnected from user root 38.102.83.198 port 45394 Feb 20 19:09:34 np0005625471.novalocal sshd-session[61064]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:34 np0005625471.novalocal systemd[1]: session-21.scope: Deactivated successfully. Feb 20 19:09:34 np0005625471.novalocal systemd-logind[833]: Session 21 logged out. Waiting for processes to exit. Feb 20 19:09:34 np0005625471.novalocal systemd-logind[833]: Removed session 21. Feb 20 19:09:36 np0005625471.novalocal systemd[1]: run-netns-testns\x2d1096070767.mount: Deactivated successfully. Feb 20 19:09:37 np0005625471.novalocal systemd[1]: run-netns-testns\x2d1642995791.mount: Deactivated successfully. Feb 20 19:09:37 np0005625471.novalocal systemd[1]: run-netns-testns\x2d2072370622.mount: Deactivated successfully. Feb 20 19:09:37 np0005625471.novalocal sshd-session[61137]: Accepted publickey for root from 38.102.83.198 port 45408 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:37 np0005625471.novalocal systemd-logind[833]: New session 22 of user root. Feb 20 19:09:37 np0005625471.novalocal systemd[1]: Started Session 22 of User root. Feb 20 19:09:38 np0005625471.novalocal sshd-session[61137]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:38 np0005625471.novalocal sshd-session[61142]: Received disconnect from 38.102.83.198 port 45408:11: disconnected by user Feb 20 19:09:38 np0005625471.novalocal sshd-session[61142]: Disconnected from user root 38.102.83.198 port 45408 Feb 20 19:09:38 np0005625471.novalocal sshd-session[61137]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:38 np0005625471.novalocal systemd[1]: session-22.scope: Deactivated successfully. Feb 20 19:09:38 np0005625471.novalocal systemd-logind[833]: Session 22 logged out. Waiting for processes to exit. Feb 20 19:09:38 np0005625471.novalocal systemd-logind[833]: Removed session 22. Feb 20 19:09:41 np0005625471.novalocal sshd-session[61178]: Accepted publickey for root from 38.102.83.198 port 58804 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:41 np0005625471.novalocal systemd-logind[833]: New session 23 of user root. Feb 20 19:09:41 np0005625471.novalocal systemd[1]: Started Session 23 of User root. Feb 20 19:09:41 np0005625471.novalocal sshd-session[61178]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:41 np0005625471.novalocal sshd-session[61181]: Received disconnect from 38.102.83.198 port 58804:11: disconnected by user Feb 20 19:09:41 np0005625471.novalocal sshd-session[61181]: Disconnected from user root 38.102.83.198 port 58804 Feb 20 19:09:41 np0005625471.novalocal sshd-session[61178]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:41 np0005625471.novalocal systemd[1]: session-23.scope: Deactivated successfully. Feb 20 19:09:41 np0005625471.novalocal systemd-logind[833]: Session 23 logged out. Waiting for processes to exit. Feb 20 19:09:41 np0005625471.novalocal systemd-logind[833]: Removed session 23. Feb 20 19:09:44 np0005625471.novalocal sshd-session[61212]: Accepted publickey for root from 38.102.83.198 port 58808 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:44 np0005625471.novalocal systemd-logind[833]: New session 24 of user root. Feb 20 19:09:44 np0005625471.novalocal systemd[1]: Started Session 24 of User root. Feb 20 19:09:44 np0005625471.novalocal sshd-session[61212]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:44 np0005625471.novalocal sshd-session[61215]: Received disconnect from 38.102.83.198 port 58808:11: disconnected by user Feb 20 19:09:44 np0005625471.novalocal sshd-session[61215]: Disconnected from user root 38.102.83.198 port 58808 Feb 20 19:09:44 np0005625471.novalocal sshd-session[61212]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:44 np0005625471.novalocal systemd[1]: session-24.scope: Deactivated successfully. Feb 20 19:09:44 np0005625471.novalocal systemd-logind[833]: Session 24 logged out. Waiting for processes to exit. Feb 20 19:09:44 np0005625471.novalocal systemd-logind[833]: Removed session 24. Feb 20 19:09:47 np0005625471.novalocal sshd-session[61246]: Accepted publickey for root from 38.102.83.198 port 58814 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:47 np0005625471.novalocal systemd-logind[833]: New session 25 of user root. Feb 20 19:09:47 np0005625471.novalocal systemd[1]: Started Session 25 of User root. Feb 20 19:09:47 np0005625471.novalocal sshd-session[61246]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:47 np0005625471.novalocal sshd-session[61249]: Received disconnect from 38.102.83.198 port 58814:11: disconnected by user Feb 20 19:09:47 np0005625471.novalocal sshd-session[61249]: Disconnected from user root 38.102.83.198 port 58814 Feb 20 19:09:47 np0005625471.novalocal sshd-session[61246]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:47 np0005625471.novalocal systemd-logind[833]: Session 25 logged out. Waiting for processes to exit. Feb 20 19:09:47 np0005625471.novalocal systemd[1]: session-25.scope: Deactivated successfully. Feb 20 19:09:47 np0005625471.novalocal systemd-logind[833]: Removed session 25. Feb 20 19:09:50 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:09:50 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:09:50 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:09:50 np0005625471.novalocal systemd-rc-local-generator[61319]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:09:50 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:09:50 np0005625471.novalocal sshd-session[61427]: Accepted publickey for root from 38.102.83.198 port 44950 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:50 np0005625471.novalocal systemd-logind[833]: New session 26 of user root. Feb 20 19:09:50 np0005625471.novalocal systemd[1]: Started Session 26 of User root. Feb 20 19:09:50 np0005625471.novalocal sshd-session[61427]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:51 np0005625471.novalocal sshd-session[61430]: Received disconnect from 38.102.83.198 port 44950:11: disconnected by user Feb 20 19:09:51 np0005625471.novalocal sshd-session[61430]: Disconnected from user root 38.102.83.198 port 44950 Feb 20 19:09:51 np0005625471.novalocal sshd-session[61427]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:51 np0005625471.novalocal systemd[1]: session-26.scope: Deactivated successfully. Feb 20 19:09:51 np0005625471.novalocal systemd-logind[833]: Session 26 logged out. Waiting for processes to exit. Feb 20 19:09:51 np0005625471.novalocal systemd-logind[833]: Removed session 26. Feb 20 19:09:51 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:09:51 np0005625471.novalocal systemd-rc-local-generator[61477]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:09:51 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:09:51 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:09:51 np0005625471.novalocal systemd[1]: run-r4954d3c6708947ba8229ffd2f0ae5506.service: Deactivated successfully. Feb 20 19:09:51 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:09:51 np0005625471.novalocal systemd-rc-local-generator[61517]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:09:51 np0005625471.novalocal systemd[1]: Starting Netfilter Tables... Feb 20 19:09:52 np0005625471.novalocal systemd[1]: Finished Netfilter Tables. Feb 20 19:09:52 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:09:52 np0005625471.novalocal systemd-rc-local-generator[61558]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:09:52 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:09:52 np0005625471.novalocal systemd-rc-local-generator[61592]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:09:52 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:09:52 np0005625471.novalocal systemd-rc-local-generator[61634]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:09:52 np0005625471.novalocal systemd[1]: Starting IPv6 firewall with ip6tables... Feb 20 19:09:52 np0005625471.novalocal ip6tables.init[61652]: ip6tables: Applying firewall rules: [ OK ] Feb 20 19:09:52 np0005625471.novalocal systemd[1]: Finished IPv6 firewall with ip6tables. Feb 20 19:09:52 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:09:52 np0005625471.novalocal systemd-rc-local-generator[61684]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:09:53 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:09:53 np0005625471.novalocal systemd-rc-local-generator[61722]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:09:54 np0005625471.novalocal sshd-session[61744]: Accepted publickey for root from 38.102.83.198 port 44952 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:54 np0005625471.novalocal systemd-logind[833]: New session 27 of user root. Feb 20 19:09:54 np0005625471.novalocal systemd[1]: Started Session 27 of User root. Feb 20 19:09:54 np0005625471.novalocal sshd-session[61744]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:54 np0005625471.novalocal sshd-session[61750]: Received disconnect from 38.102.83.198 port 44952:11: disconnected by user Feb 20 19:09:54 np0005625471.novalocal sshd-session[61750]: Disconnected from user root 38.102.83.198 port 44952 Feb 20 19:09:54 np0005625471.novalocal sshd-session[61744]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:54 np0005625471.novalocal systemd[1]: session-27.scope: Deactivated successfully. Feb 20 19:09:54 np0005625471.novalocal systemd-logind[833]: Session 27 logged out. Waiting for processes to exit. Feb 20 19:09:54 np0005625471.novalocal systemd-logind[833]: Removed session 27. Feb 20 19:09:57 np0005625471.novalocal sshd-session[61802]: Accepted publickey for root from 38.102.83.198 port 44966 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:09:57 np0005625471.novalocal systemd-logind[833]: New session 28 of user root. Feb 20 19:09:57 np0005625471.novalocal systemd[1]: Started Session 28 of User root. Feb 20 19:09:57 np0005625471.novalocal sshd-session[61802]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:09:57 np0005625471.novalocal sshd-session[61805]: Received disconnect from 38.102.83.198 port 44966:11: disconnected by user Feb 20 19:09:57 np0005625471.novalocal sshd-session[61805]: Disconnected from user root 38.102.83.198 port 44966 Feb 20 19:09:57 np0005625471.novalocal sshd-session[61802]: pam_unix(sshd:session): session closed for user root Feb 20 19:09:57 np0005625471.novalocal systemd[1]: session-28.scope: Deactivated successfully. Feb 20 19:09:57 np0005625471.novalocal systemd-logind[833]: Session 28 logged out. Waiting for processes to exit. Feb 20 19:09:57 np0005625471.novalocal systemd-logind[833]: Removed session 28. Feb 20 19:10:00 np0005625471.novalocal sshd-session[61837]: Accepted publickey for root from 38.102.83.198 port 40622 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:00 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:10:00 np0005625471.novalocal systemd-logind[833]: New session 29 of user root. Feb 20 19:10:00 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:10:00 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:10:00 np0005625471.novalocal systemd[1]: Started Session 29 of User root. Feb 20 19:10:00 np0005625471.novalocal sshd-session[61837]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:00 np0005625471.novalocal sshd-session[61841]: Received disconnect from 38.102.83.198 port 40622:11: disconnected by user Feb 20 19:10:00 np0005625471.novalocal sshd-session[61841]: Disconnected from user root 38.102.83.198 port 40622 Feb 20 19:10:00 np0005625471.novalocal sshd-session[61837]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:00 np0005625471.novalocal systemd-logind[833]: Session 29 logged out. Waiting for processes to exit. Feb 20 19:10:00 np0005625471.novalocal systemd[1]: session-29.scope: Deactivated successfully. Feb 20 19:10:00 np0005625471.novalocal systemd-logind[833]: Removed session 29. Feb 20 19:10:04 np0005625471.novalocal sshd-session[61872]: Accepted publickey for root from 38.102.83.198 port 40628 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:04 np0005625471.novalocal systemd-logind[833]: New session 30 of user root. Feb 20 19:10:04 np0005625471.novalocal systemd[1]: Started Session 30 of User root. Feb 20 19:10:04 np0005625471.novalocal sshd-session[61872]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:04 np0005625471.novalocal sshd-session[61875]: Received disconnect from 38.102.83.198 port 40628:11: disconnected by user Feb 20 19:10:04 np0005625471.novalocal sshd-session[61875]: Disconnected from user root 38.102.83.198 port 40628 Feb 20 19:10:04 np0005625471.novalocal sshd-session[61872]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:04 np0005625471.novalocal systemd[1]: session-30.scope: Deactivated successfully. Feb 20 19:10:04 np0005625471.novalocal systemd-logind[833]: Session 30 logged out. Waiting for processes to exit. Feb 20 19:10:04 np0005625471.novalocal systemd-logind[833]: Removed session 30. Feb 20 19:10:06 np0005625471.novalocal kernel: SELinux: Converting 2744 SID table entries... Feb 20 19:10:06 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:10:06 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:10:06 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:10:06 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:10:06 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:10:06 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:10:06 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:10:06 np0005625471.novalocal groupadd[61910]: group added to /etc/group: name=mysql, GID=27 Feb 20 19:10:06 np0005625471.novalocal groupadd[61910]: group added to /etc/gshadow: name=mysql Feb 20 19:10:06 np0005625471.novalocal groupadd[61910]: new group: name=mysql, GID=27 Feb 20 19:10:06 np0005625471.novalocal useradd[61916]: new user: name=mysql, UID=27, GID=27, home=/var/lib/mysql, shell=/sbin/nologin, from=none Feb 20 19:10:07 np0005625471.novalocal sshd-session[61926]: Accepted publickey for root from 38.102.83.198 port 40644 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:07 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=8 res=1 Feb 20 19:10:07 np0005625471.novalocal systemd-logind[833]: New session 31 of user root. Feb 20 19:10:07 np0005625471.novalocal systemd[1]: Started Session 31 of User root. Feb 20 19:10:07 np0005625471.novalocal sshd-session[61926]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:07 np0005625471.novalocal sshd-session[61930]: Received disconnect from 38.102.83.198 port 40644:11: disconnected by user Feb 20 19:10:07 np0005625471.novalocal sshd-session[61930]: Disconnected from user root 38.102.83.198 port 40644 Feb 20 19:10:07 np0005625471.novalocal sshd-session[61926]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:07 np0005625471.novalocal systemd[1]: session-31.scope: Deactivated successfully. Feb 20 19:10:07 np0005625471.novalocal systemd-logind[833]: Session 31 logged out. Waiting for processes to exit. Feb 20 19:10:07 np0005625471.novalocal systemd-logind[833]: Removed session 31. Feb 20 19:10:08 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:10:08 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:10:08 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:10:08 np0005625471.novalocal systemd-rc-local-generator[62456]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:10:08 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:10:10 np0005625471.novalocal sshd-session[63681]: Accepted publickey for root from 38.102.83.198 port 38124 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:10 np0005625471.novalocal systemd-logind[833]: New session 32 of user root. Feb 20 19:10:10 np0005625471.novalocal systemd[1]: Started Session 32 of User root. Feb 20 19:10:10 np0005625471.novalocal sshd-session[63681]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:10 np0005625471.novalocal sshd-session[63789]: Received disconnect from 38.102.83.198 port 38124:11: disconnected by user Feb 20 19:10:10 np0005625471.novalocal sshd-session[63789]: Disconnected from user root 38.102.83.198 port 38124 Feb 20 19:10:10 np0005625471.novalocal sshd-session[63681]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:10 np0005625471.novalocal systemd[1]: session-32.scope: Deactivated successfully. Feb 20 19:10:10 np0005625471.novalocal systemd-logind[833]: Session 32 logged out. Waiting for processes to exit. Feb 20 19:10:10 np0005625471.novalocal systemd-logind[833]: Removed session 32. Feb 20 19:10:11 np0005625471.novalocal useradd[64559]: new group: name=garb, GID=989 Feb 20 19:10:11 np0005625471.novalocal useradd[64559]: new user: name=garb, UID=989, GID=989, home=/dev/null, shell=/sbin/nologin, from=none Feb 20 19:10:13 np0005625471.novalocal kernel: SELinux: Converting 2744 SID table entries... Feb 20 19:10:13 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:10:13 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:10:13 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:10:13 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:10:13 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:10:13 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:10:13 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:10:13 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=9 res=1 Feb 20 19:10:13 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:10:13 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:10:13 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Consumed 3.963s CPU time. Feb 20 19:10:13 np0005625471.novalocal systemd[1]: run-ra1aa6be023e1428b9ffb6e6050e2a2e9.service: Deactivated successfully. Feb 20 19:10:13 np0005625471.novalocal sshd-session[65798]: Accepted publickey for root from 38.102.83.198 port 38134 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:13 np0005625471.novalocal systemd-logind[833]: New session 33 of user root. Feb 20 19:10:13 np0005625471.novalocal systemd[1]: Started Session 33 of User root. Feb 20 19:10:13 np0005625471.novalocal sshd-session[65798]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:13 np0005625471.novalocal sshd-session[65801]: Received disconnect from 38.102.83.198 port 38134:11: disconnected by user Feb 20 19:10:13 np0005625471.novalocal sshd-session[65801]: Disconnected from user root 38.102.83.198 port 38134 Feb 20 19:10:13 np0005625471.novalocal sshd-session[65798]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:13 np0005625471.novalocal systemd-logind[833]: Session 33 logged out. Waiting for processes to exit. Feb 20 19:10:13 np0005625471.novalocal systemd[1]: session-33.scope: Deactivated successfully. Feb 20 19:10:13 np0005625471.novalocal systemd-logind[833]: Removed session 33. Feb 20 19:10:14 np0005625471.novalocal kernel: SELinux: Converting 2744 SID table entries... Feb 20 19:10:14 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:10:14 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:10:14 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:10:14 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:10:14 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:10:14 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:10:14 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:10:15 np0005625471.novalocal kernel: SELinux: Converting 2744 SID table entries... Feb 20 19:10:15 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:10:15 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:10:15 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:10:15 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:10:15 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:10:15 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:10:15 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:10:17 np0005625471.novalocal kernel: SELinux: Converting 2744 SID table entries... Feb 20 19:10:17 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:10:17 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:10:17 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:10:17 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:10:17 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:10:17 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:10:17 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:10:17 np0005625471.novalocal sshd-session[65849]: Accepted publickey for root from 38.102.83.198 port 38138 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:17 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=12 res=1 Feb 20 19:10:17 np0005625471.novalocal systemd-logind[833]: New session 34 of user root. Feb 20 19:10:17 np0005625471.novalocal systemd[1]: Started Session 34 of User root. Feb 20 19:10:17 np0005625471.novalocal sshd-session[65849]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:17 np0005625471.novalocal sshd-session[65852]: Received disconnect from 38.102.83.198 port 38138:11: disconnected by user Feb 20 19:10:17 np0005625471.novalocal sshd-session[65852]: Disconnected from user root 38.102.83.198 port 38138 Feb 20 19:10:17 np0005625471.novalocal sshd-session[65849]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:17 np0005625471.novalocal systemd[1]: session-34.scope: Deactivated successfully. Feb 20 19:10:17 np0005625471.novalocal systemd-logind[833]: Session 34 logged out. Waiting for processes to exit. Feb 20 19:10:17 np0005625471.novalocal systemd-logind[833]: Removed session 34. Feb 20 19:10:20 np0005625471.novalocal sshd-session[65885]: Accepted publickey for root from 38.102.83.198 port 51108 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:20 np0005625471.novalocal systemd-logind[833]: New session 35 of user root. Feb 20 19:10:20 np0005625471.novalocal systemd[1]: Started Session 35 of User root. Feb 20 19:10:20 np0005625471.novalocal sshd-session[65885]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:20 np0005625471.novalocal sshd-session[65888]: Received disconnect from 38.102.83.198 port 51108:11: disconnected by user Feb 20 19:10:20 np0005625471.novalocal sshd-session[65888]: Disconnected from user root 38.102.83.198 port 51108 Feb 20 19:10:20 np0005625471.novalocal sshd-session[65885]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:20 np0005625471.novalocal systemd[1]: session-35.scope: Deactivated successfully. Feb 20 19:10:20 np0005625471.novalocal systemd-logind[833]: Session 35 logged out. Waiting for processes to exit. Feb 20 19:10:20 np0005625471.novalocal systemd-logind[833]: Removed session 35. Feb 20 19:10:23 np0005625471.novalocal sshd-session[65919]: Accepted publickey for root from 38.102.83.198 port 51116 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:23 np0005625471.novalocal systemd-logind[833]: New session 36 of user root. Feb 20 19:10:23 np0005625471.novalocal systemd[1]: Started Session 36 of User root. Feb 20 19:10:23 np0005625471.novalocal sshd-session[65919]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:23 np0005625471.novalocal sshd-session[65922]: Received disconnect from 38.102.83.198 port 51116:11: disconnected by user Feb 20 19:10:23 np0005625471.novalocal sshd-session[65922]: Disconnected from user root 38.102.83.198 port 51116 Feb 20 19:10:23 np0005625471.novalocal sshd-session[65919]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:23 np0005625471.novalocal systemd-logind[833]: Session 36 logged out. Waiting for processes to exit. Feb 20 19:10:23 np0005625471.novalocal systemd[1]: session-36.scope: Deactivated successfully. Feb 20 19:10:23 np0005625471.novalocal systemd-logind[833]: Removed session 36. Feb 20 19:10:26 np0005625471.novalocal kernel: SELinux: Converting 2744 SID table entries... Feb 20 19:10:26 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:10:26 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:10:26 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:10:26 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:10:26 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:10:26 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:10:26 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:10:26 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=13 res=1 Feb 20 19:10:26 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:10:26 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:10:26 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:10:26 np0005625471.novalocal systemd-rc-local-generator[65980]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:10:26 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:10:26 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:10:26 np0005625471.novalocal sshd-session[66003]: Accepted publickey for root from 38.102.83.198 port 51126 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:26 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:10:26 np0005625471.novalocal systemd[1]: run-r9ee4d905b05b4677b176affb9f4f4651.service: Deactivated successfully. Feb 20 19:10:26 np0005625471.novalocal systemd-logind[833]: New session 37 of user root. Feb 20 19:10:26 np0005625471.novalocal systemd[1]: Started Session 37 of User root. Feb 20 19:10:26 np0005625471.novalocal sshd-session[66003]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:27 np0005625471.novalocal sshd-session[66007]: Received disconnect from 38.102.83.198 port 51126:11: disconnected by user Feb 20 19:10:27 np0005625471.novalocal sshd-session[66007]: Disconnected from user root 38.102.83.198 port 51126 Feb 20 19:10:27 np0005625471.novalocal sshd-session[66003]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:27 np0005625471.novalocal systemd[1]: session-37.scope: Deactivated successfully. Feb 20 19:10:27 np0005625471.novalocal systemd-logind[833]: Session 37 logged out. Waiting for processes to exit. Feb 20 19:10:27 np0005625471.novalocal systemd-logind[833]: Removed session 37. Feb 20 19:10:28 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:10:28 np0005625471.novalocal systemd-rc-local-generator[66138]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:10:28 np0005625471.novalocal systemd[1]: Starting MariaDB 10.5 database server... Feb 20 19:10:28 np0005625471.novalocal mariadb-prepare-db-dir[66181]: Database MariaDB is probably initialized in /var/lib/mysql already, nothing is done. Feb 20 19:10:28 np0005625471.novalocal mariadb-prepare-db-dir[66181]: If this is not the case, make sure the /var/lib/mysql is empty before running mariadb-prepare-db-dir. Feb 20 19:10:29 np0005625471.novalocal mariadbd[66216]: 2026-02-20 19:10:29 0 [Warning] option 'open_files_limit': unsigned value 18446744073709551615 adjusted to 4294967295 Feb 20 19:10:29 np0005625471.novalocal mariadbd[66216]: 2026-02-20 19:10:29 0 [Warning] Could not increase number of max_open_files to more than 1024 (request: 4294967295) Feb 20 19:10:29 np0005625471.novalocal mariadbd[66216]: 2026-02-20 19:10:29 0 [Warning] Changed limits: max_open_files: 1024 max_connections: 256 (was 256) table_cache: 369 (was 2000) Feb 20 19:10:29 np0005625471.novalocal systemd[1]: Started MariaDB 10.5 database server. Feb 20 19:10:29 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:10:29 np0005625471.novalocal systemd-rc-local-generator[66293]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:10:29 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:10:29 np0005625471.novalocal systemd-rc-local-generator[66327]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:10:30 np0005625471.novalocal sshd-session[66365]: Accepted publickey for root from 38.102.83.198 port 52468 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:30 np0005625471.novalocal systemd-logind[833]: New session 38 of user root. Feb 20 19:10:30 np0005625471.novalocal systemd[1]: Started Session 38 of User root. Feb 20 19:10:30 np0005625471.novalocal sshd-session[66365]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:30 np0005625471.novalocal sshd-session[66368]: Received disconnect from 38.102.83.198 port 52468:11: disconnected by user Feb 20 19:10:30 np0005625471.novalocal sshd-session[66368]: Disconnected from user root 38.102.83.198 port 52468 Feb 20 19:10:30 np0005625471.novalocal sshd-session[66365]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:30 np0005625471.novalocal systemd[1]: session-38.scope: Deactivated successfully. Feb 20 19:10:30 np0005625471.novalocal systemd-logind[833]: Session 38 logged out. Waiting for processes to exit. Feb 20 19:10:30 np0005625471.novalocal systemd-logind[833]: Removed session 38. Feb 20 19:10:31 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:10:31 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:10:31 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:10:31 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:10:31 np0005625471.novalocal systemd[1]: run-r3eb0fac2b64e4ed2926dfac44752c03c.service: Deactivated successfully. Feb 20 19:10:33 np0005625471.novalocal sshd-session[66436]: Accepted publickey for root from 38.102.83.198 port 52476 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:33 np0005625471.novalocal systemd-logind[833]: New session 39 of user root. Feb 20 19:10:33 np0005625471.novalocal systemd[1]: Started Session 39 of User root. Feb 20 19:10:33 np0005625471.novalocal sshd-session[66436]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:33 np0005625471.novalocal sshd-session[66439]: Received disconnect from 38.102.83.198 port 52476:11: disconnected by user Feb 20 19:10:33 np0005625471.novalocal sshd-session[66439]: Disconnected from user root 38.102.83.198 port 52476 Feb 20 19:10:33 np0005625471.novalocal sshd-session[66436]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:33 np0005625471.novalocal systemd[1]: session-39.scope: Deactivated successfully. Feb 20 19:10:33 np0005625471.novalocal systemd-logind[833]: Session 39 logged out. Waiting for processes to exit. Feb 20 19:10:33 np0005625471.novalocal systemd-logind[833]: Removed session 39. Feb 20 19:10:36 np0005625471.novalocal sshd-session[66491]: Accepted publickey for root from 38.102.83.198 port 52484 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:36 np0005625471.novalocal systemd-logind[833]: New session 40 of user root. Feb 20 19:10:36 np0005625471.novalocal systemd[1]: Started Session 40 of User root. Feb 20 19:10:36 np0005625471.novalocal sshd-session[66491]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:36 np0005625471.novalocal sshd-session[66494]: Received disconnect from 38.102.83.198 port 52484:11: disconnected by user Feb 20 19:10:36 np0005625471.novalocal sshd-session[66494]: Disconnected from user root 38.102.83.198 port 52484 Feb 20 19:10:36 np0005625471.novalocal sshd-session[66491]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:36 np0005625471.novalocal systemd[1]: session-40.scope: Deactivated successfully. Feb 20 19:10:36 np0005625471.novalocal systemd-logind[833]: Session 40 logged out. Waiting for processes to exit. Feb 20 19:10:36 np0005625471.novalocal systemd-logind[833]: Removed session 40. Feb 20 19:10:39 np0005625471.novalocal sshd-session[66552]: Accepted publickey for root from 38.102.83.198 port 53260 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:39 np0005625471.novalocal systemd-logind[833]: New session 41 of user root. Feb 20 19:10:39 np0005625471.novalocal systemd[1]: Started Session 41 of User root. Feb 20 19:10:39 np0005625471.novalocal sshd-session[66552]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:40 np0005625471.novalocal sshd-session[66558]: Received disconnect from 38.102.83.198 port 53260:11: disconnected by user Feb 20 19:10:40 np0005625471.novalocal sshd-session[66558]: Disconnected from user root 38.102.83.198 port 53260 Feb 20 19:10:40 np0005625471.novalocal sshd-session[66552]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:40 np0005625471.novalocal systemd[1]: session-41.scope: Deactivated successfully. Feb 20 19:10:40 np0005625471.novalocal systemd-logind[833]: Session 41 logged out. Waiting for processes to exit. Feb 20 19:10:40 np0005625471.novalocal systemd-logind[833]: Removed session 41. Feb 20 19:10:43 np0005625471.novalocal sshd-session[66594]: Accepted publickey for root from 38.102.83.198 port 53276 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:43 np0005625471.novalocal systemd-logind[833]: New session 42 of user root. Feb 20 19:10:43 np0005625471.novalocal systemd[1]: Started Session 42 of User root. Feb 20 19:10:43 np0005625471.novalocal sshd-session[66594]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:43 np0005625471.novalocal sshd-session[66597]: Received disconnect from 38.102.83.198 port 53276:11: disconnected by user Feb 20 19:10:43 np0005625471.novalocal sshd-session[66597]: Disconnected from user root 38.102.83.198 port 53276 Feb 20 19:10:43 np0005625471.novalocal sshd-session[66594]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:43 np0005625471.novalocal systemd[1]: session-42.scope: Deactivated successfully. Feb 20 19:10:43 np0005625471.novalocal systemd-logind[833]: Session 42 logged out. Waiting for processes to exit. Feb 20 19:10:43 np0005625471.novalocal systemd-logind[833]: Removed session 42. Feb 20 19:10:44 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:10:44 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:10:45 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:10:45 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:10:45 np0005625471.novalocal systemd[1]: run-r548336aa40d340559e2a708ff20842e9.service: Deactivated successfully. Feb 20 19:10:46 np0005625471.novalocal sshd-session[66914]: Accepted publickey for root from 38.102.83.198 port 53284 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:46 np0005625471.novalocal systemd-logind[833]: New session 43 of user root. Feb 20 19:10:46 np0005625471.novalocal systemd[1]: Started Session 43 of User root. Feb 20 19:10:46 np0005625471.novalocal sshd-session[66914]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:46 np0005625471.novalocal sshd-session[66917]: Received disconnect from 38.102.83.198 port 53284:11: disconnected by user Feb 20 19:10:46 np0005625471.novalocal sshd-session[66917]: Disconnected from user root 38.102.83.198 port 53284 Feb 20 19:10:46 np0005625471.novalocal sshd-session[66914]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:46 np0005625471.novalocal systemd[1]: session-43.scope: Deactivated successfully. Feb 20 19:10:46 np0005625471.novalocal systemd-logind[833]: Session 43 logged out. Waiting for processes to exit. Feb 20 19:10:46 np0005625471.novalocal systemd-logind[833]: Removed session 43. Feb 20 19:10:49 np0005625471.novalocal sshd-session[66970]: Accepted publickey for root from 38.102.83.198 port 40888 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:49 np0005625471.novalocal systemd-logind[833]: New session 44 of user root. Feb 20 19:10:49 np0005625471.novalocal systemd[1]: Started Session 44 of User root. Feb 20 19:10:49 np0005625471.novalocal sshd-session[66970]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:49 np0005625471.novalocal sshd-session[66977]: Received disconnect from 38.102.83.198 port 40888:11: disconnected by user Feb 20 19:10:49 np0005625471.novalocal sshd-session[66977]: Disconnected from user root 38.102.83.198 port 40888 Feb 20 19:10:49 np0005625471.novalocal sshd-session[66970]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:49 np0005625471.novalocal systemd[1]: session-44.scope: Deactivated successfully. Feb 20 19:10:49 np0005625471.novalocal systemd-logind[833]: Session 44 logged out. Waiting for processes to exit. Feb 20 19:10:49 np0005625471.novalocal systemd-logind[833]: Removed session 44. Feb 20 19:10:52 np0005625471.novalocal sshd-session[67057]: Accepted publickey for root from 38.102.83.198 port 40904 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:52 np0005625471.novalocal systemd-logind[833]: New session 45 of user root. Feb 20 19:10:52 np0005625471.novalocal systemd[1]: Started Session 45 of User root. Feb 20 19:10:52 np0005625471.novalocal sshd-session[67057]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:53 np0005625471.novalocal sshd-session[67060]: Received disconnect from 38.102.83.198 port 40904:11: disconnected by user Feb 20 19:10:53 np0005625471.novalocal sshd-session[67060]: Disconnected from user root 38.102.83.198 port 40904 Feb 20 19:10:53 np0005625471.novalocal sshd-session[67057]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:53 np0005625471.novalocal systemd-logind[833]: Session 45 logged out. Waiting for processes to exit. Feb 20 19:10:53 np0005625471.novalocal systemd[1]: session-45.scope: Deactivated successfully. Feb 20 19:10:53 np0005625471.novalocal systemd-logind[833]: Removed session 45. Feb 20 19:10:56 np0005625471.novalocal sshd-session[67097]: Accepted publickey for root from 38.102.83.198 port 40918 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:56 np0005625471.novalocal systemd-logind[833]: New session 46 of user root. Feb 20 19:10:56 np0005625471.novalocal systemd[1]: Started Session 46 of User root. Feb 20 19:10:56 np0005625471.novalocal sshd-session[67097]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:56 np0005625471.novalocal sshd-session[67100]: Received disconnect from 38.102.83.198 port 40918:11: disconnected by user Feb 20 19:10:56 np0005625471.novalocal sshd-session[67100]: Disconnected from user root 38.102.83.198 port 40918 Feb 20 19:10:56 np0005625471.novalocal sshd-session[67097]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:56 np0005625471.novalocal systemd[1]: session-46.scope: Deactivated successfully. Feb 20 19:10:56 np0005625471.novalocal systemd-logind[833]: Session 46 logged out. Waiting for processes to exit. Feb 20 19:10:56 np0005625471.novalocal systemd-logind[833]: Removed session 46. Feb 20 19:10:59 np0005625471.novalocal sshd-session[67131]: Accepted publickey for root from 38.102.83.198 port 48662 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:10:59 np0005625471.novalocal systemd-logind[833]: New session 47 of user root. Feb 20 19:10:59 np0005625471.novalocal systemd[1]: Started Session 47 of User root. Feb 20 19:10:59 np0005625471.novalocal sshd-session[67131]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:10:59 np0005625471.novalocal sshd-session[67134]: Received disconnect from 38.102.83.198 port 48662:11: disconnected by user Feb 20 19:10:59 np0005625471.novalocal sshd-session[67134]: Disconnected from user root 38.102.83.198 port 48662 Feb 20 19:10:59 np0005625471.novalocal sshd-session[67131]: pam_unix(sshd:session): session closed for user root Feb 20 19:10:59 np0005625471.novalocal systemd-logind[833]: Session 47 logged out. Waiting for processes to exit. Feb 20 19:10:59 np0005625471.novalocal systemd[1]: session-47.scope: Deactivated successfully. Feb 20 19:10:59 np0005625471.novalocal systemd-logind[833]: Removed session 47. Feb 20 19:11:02 np0005625471.novalocal sshd-session[67165]: Accepted publickey for root from 38.102.83.198 port 48664 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:02 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:11:02 np0005625471.novalocal systemd-logind[833]: New session 48 of user root. Feb 20 19:11:02 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:11:02 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:11:02 np0005625471.novalocal systemd[1]: Started Session 48 of User root. Feb 20 19:11:02 np0005625471.novalocal sshd-session[67165]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:02 np0005625471.novalocal sshd-session[67169]: Received disconnect from 38.102.83.198 port 48664:11: disconnected by user Feb 20 19:11:02 np0005625471.novalocal sshd-session[67169]: Disconnected from user root 38.102.83.198 port 48664 Feb 20 19:11:02 np0005625471.novalocal sshd-session[67165]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:02 np0005625471.novalocal systemd-logind[833]: Session 48 logged out. Waiting for processes to exit. Feb 20 19:11:02 np0005625471.novalocal systemd[1]: session-48.scope: Deactivated successfully. Feb 20 19:11:02 np0005625471.novalocal systemd-logind[833]: Removed session 48. Feb 20 19:11:03 np0005625471.novalocal kernel: SELinux: Converting 2750 SID table entries... Feb 20 19:11:03 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:11:03 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:11:03 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:11:03 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:11:03 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:11:03 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:11:03 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:11:03 np0005625471.novalocal groupadd[67205]: group added to /etc/group: name=memcached, GID=988 Feb 20 19:11:03 np0005625471.novalocal groupadd[67205]: group added to /etc/gshadow: name=memcached Feb 20 19:11:03 np0005625471.novalocal groupadd[67205]: new group: name=memcached, GID=988 Feb 20 19:11:03 np0005625471.novalocal useradd[67212]: new user: name=memcached, UID=988, GID=988, home=/, shell=/sbin/nologin, from=none Feb 20 19:11:06 np0005625471.novalocal sshd-session[67225]: Accepted publickey for root from 38.102.83.198 port 48676 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:06 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=14 res=1 Feb 20 19:11:06 np0005625471.novalocal systemd-logind[833]: New session 49 of user root. Feb 20 19:11:06 np0005625471.novalocal systemd[1]: Started Session 49 of User root. Feb 20 19:11:06 np0005625471.novalocal sshd-session[67225]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:06 np0005625471.novalocal sshd-session[67228]: Received disconnect from 38.102.83.198 port 48676:11: disconnected by user Feb 20 19:11:06 np0005625471.novalocal sshd-session[67228]: Disconnected from user root 38.102.83.198 port 48676 Feb 20 19:11:06 np0005625471.novalocal sshd-session[67225]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:06 np0005625471.novalocal systemd-logind[833]: Session 49 logged out. Waiting for processes to exit. Feb 20 19:11:06 np0005625471.novalocal systemd[1]: session-49.scope: Deactivated successfully. Feb 20 19:11:06 np0005625471.novalocal systemd-logind[833]: Removed session 49. Feb 20 19:11:08 np0005625471.novalocal groupadd[67258]: group added to /etc/group: name=keystone, GID=163 Feb 20 19:11:08 np0005625471.novalocal groupadd[67258]: group added to /etc/gshadow: name=keystone Feb 20 19:11:08 np0005625471.novalocal groupadd[67258]: new group: name=keystone, GID=163 Feb 20 19:11:08 np0005625471.novalocal useradd[67265]: new user: name=keystone, UID=163, GID=163, home=/var/lib/keystone, shell=/sbin/nologin, from=none Feb 20 19:11:09 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:11:09 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:11:09 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:11:09 np0005625471.novalocal systemd-rc-local-generator[67737]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:11:09 np0005625471.novalocal sshd-session[67719]: Accepted publickey for root from 38.102.83.198 port 41318 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:09 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:11:09 np0005625471.novalocal systemd-logind[833]: New session 50 of user root. Feb 20 19:11:09 np0005625471.novalocal systemd[1]: Started Session 50 of User root. Feb 20 19:11:09 np0005625471.novalocal sshd-session[67719]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:09 np0005625471.novalocal sshd-session[67758]: Received disconnect from 38.102.83.198 port 41318:11: disconnected by user Feb 20 19:11:09 np0005625471.novalocal sshd-session[67758]: Disconnected from user root 38.102.83.198 port 41318 Feb 20 19:11:09 np0005625471.novalocal sshd-session[67719]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:09 np0005625471.novalocal systemd[1]: session-50.scope: Deactivated successfully. Feb 20 19:11:09 np0005625471.novalocal systemd-logind[833]: Session 50 logged out. Waiting for processes to exit. Feb 20 19:11:09 np0005625471.novalocal systemd-logind[833]: Removed session 50. Feb 20 19:11:09 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:11:09 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:11:09 np0005625471.novalocal systemd[1]: run-r00028c5708c54ed992cc69fdce6bcc20.service: Deactivated successfully. Feb 20 19:11:12 np0005625471.novalocal sshd-session[67955]: Accepted publickey for root from 38.102.83.198 port 41324 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:12 np0005625471.novalocal systemd-logind[833]: New session 51 of user root. Feb 20 19:11:12 np0005625471.novalocal systemd[1]: Started Session 51 of User root. Feb 20 19:11:12 np0005625471.novalocal sshd-session[67955]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:12 np0005625471.novalocal sshd-session[67958]: Received disconnect from 38.102.83.198 port 41324:11: disconnected by user Feb 20 19:11:12 np0005625471.novalocal sshd-session[67958]: Disconnected from user root 38.102.83.198 port 41324 Feb 20 19:11:12 np0005625471.novalocal sshd-session[67955]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:12 np0005625471.novalocal systemd[1]: session-51.scope: Deactivated successfully. Feb 20 19:11:12 np0005625471.novalocal systemd-logind[833]: Session 51 logged out. Waiting for processes to exit. Feb 20 19:11:12 np0005625471.novalocal systemd-logind[833]: Removed session 51. Feb 20 19:11:15 np0005625471.novalocal sshd-session[67990]: Accepted publickey for root from 38.102.83.198 port 41328 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:15 np0005625471.novalocal systemd-logind[833]: New session 52 of user root. Feb 20 19:11:15 np0005625471.novalocal systemd[1]: Started Session 52 of User root. Feb 20 19:11:15 np0005625471.novalocal sshd-session[67990]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:16 np0005625471.novalocal sshd-session[67993]: Received disconnect from 38.102.83.198 port 41328:11: disconnected by user Feb 20 19:11:16 np0005625471.novalocal sshd-session[67993]: Disconnected from user root 38.102.83.198 port 41328 Feb 20 19:11:16 np0005625471.novalocal sshd-session[67990]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:16 np0005625471.novalocal systemd[1]: session-52.scope: Deactivated successfully. Feb 20 19:11:16 np0005625471.novalocal systemd-logind[833]: Session 52 logged out. Waiting for processes to exit. Feb 20 19:11:16 np0005625471.novalocal systemd-logind[833]: Removed session 52. Feb 20 19:11:19 np0005625471.novalocal sshd-session[68090]: Accepted publickey for root from 38.102.83.198 port 41344 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:19 np0005625471.novalocal systemd-logind[833]: New session 53 of user root. Feb 20 19:11:19 np0005625471.novalocal systemd[1]: Started Session 53 of User root. Feb 20 19:11:19 np0005625471.novalocal sshd-session[68090]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:19 np0005625471.novalocal sshd-session[68097]: Received disconnect from 38.102.83.198 port 41344:11: disconnected by user Feb 20 19:11:19 np0005625471.novalocal sshd-session[68097]: Disconnected from user root 38.102.83.198 port 41344 Feb 20 19:11:19 np0005625471.novalocal sshd-session[68090]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:19 np0005625471.novalocal systemd[1]: session-53.scope: Deactivated successfully. Feb 20 19:11:19 np0005625471.novalocal systemd-logind[833]: Session 53 logged out. Waiting for processes to exit. Feb 20 19:11:19 np0005625471.novalocal systemd-logind[833]: Removed session 53. Feb 20 19:11:22 np0005625471.novalocal sshd-session[68145]: Accepted publickey for root from 38.102.83.198 port 48916 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:22 np0005625471.novalocal systemd-logind[833]: New session 54 of user root. Feb 20 19:11:22 np0005625471.novalocal systemd[1]: Started Session 54 of User root. Feb 20 19:11:22 np0005625471.novalocal sshd-session[68145]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:22 np0005625471.novalocal sshd-session[68148]: Received disconnect from 38.102.83.198 port 48916:11: disconnected by user Feb 20 19:11:22 np0005625471.novalocal sshd-session[68148]: Disconnected from user root 38.102.83.198 port 48916 Feb 20 19:11:22 np0005625471.novalocal sshd-session[68145]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:22 np0005625471.novalocal systemd[1]: session-54.scope: Deactivated successfully. Feb 20 19:11:22 np0005625471.novalocal systemd-logind[833]: Session 54 logged out. Waiting for processes to exit. Feb 20 19:11:22 np0005625471.novalocal systemd-logind[833]: Removed session 54. Feb 20 19:11:23 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:11:23 np0005625471.novalocal systemd-rc-local-generator[68197]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:11:23 np0005625471.novalocal systemd[1]: Listening on Device-mapper event daemon FIFOs. Feb 20 19:11:23 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:11:23 np0005625471.novalocal systemd-rc-local-generator[68234]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:11:24 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:11:24 np0005625471.novalocal systemd-rc-local-generator[68272]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:11:24 np0005625471.novalocal systemd-logind[833]: Watching system buttons on /dev/input/event1 (AT Translated Set 2 keyboard) Feb 20 19:11:24 np0005625471.novalocal systemd-logind[833]: Watching system buttons on /dev/input/event0 (Power Button) Feb 20 19:11:25 np0005625471.novalocal sshd-session[68345]: Accepted publickey for root from 38.102.83.198 port 48932 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:25 np0005625471.novalocal systemd-logind[833]: New session 55 of user root. Feb 20 19:11:25 np0005625471.novalocal systemd[1]: Started Session 55 of User root. Feb 20 19:11:25 np0005625471.novalocal sshd-session[68345]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:25 np0005625471.novalocal sshd-session[68348]: Received disconnect from 38.102.83.198 port 48932:11: disconnected by user Feb 20 19:11:25 np0005625471.novalocal sshd-session[68348]: Disconnected from user root 38.102.83.198 port 48932 Feb 20 19:11:25 np0005625471.novalocal sshd-session[68345]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:25 np0005625471.novalocal systemd[1]: session-55.scope: Deactivated successfully. Feb 20 19:11:25 np0005625471.novalocal systemd-logind[833]: Session 55 logged out. Waiting for processes to exit. Feb 20 19:11:25 np0005625471.novalocal systemd-logind[833]: Removed session 55. Feb 20 19:11:28 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:11:28 np0005625471.novalocal sshd-session[68389]: Accepted publickey for root from 38.102.83.198 port 48944 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:28 np0005625471.novalocal systemd-rc-local-generator[68406]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:11:29 np0005625471.novalocal systemd-logind[833]: New session 56 of user root. Feb 20 19:11:29 np0005625471.novalocal systemd[1]: Started Session 56 of User root. Feb 20 19:11:29 np0005625471.novalocal systemd[1]: Starting Monitoring of LVM2 mirrors, snapshots etc. using dmeventd or progress polling... Feb 20 19:11:29 np0005625471.novalocal sshd-session[68389]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:29 np0005625471.novalocal systemd[1]: Finished Monitoring of LVM2 mirrors, snapshots etc. using dmeventd or progress polling. Feb 20 19:11:29 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:11:29 np0005625471.novalocal sshd-session[68429]: Received disconnect from 38.102.83.198 port 48944:11: disconnected by user Feb 20 19:11:29 np0005625471.novalocal sshd-session[68429]: Disconnected from user root 38.102.83.198 port 48944 Feb 20 19:11:29 np0005625471.novalocal systemd-rc-local-generator[68475]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:11:29 np0005625471.novalocal sshd-session[68389]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:29 np0005625471.novalocal systemd[1]: session-56.scope: Deactivated successfully. Feb 20 19:11:29 np0005625471.novalocal systemd-logind[833]: Session 56 logged out. Waiting for processes to exit. Feb 20 19:11:29 np0005625471.novalocal systemd-logind[833]: Removed session 56. Feb 20 19:11:29 np0005625471.novalocal systemd[1]: Listening on LVM2 poll daemon socket. Feb 20 19:11:32 np0005625471.novalocal sshd-session[68502]: Accepted publickey for root from 38.102.83.198 port 34804 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:32 np0005625471.novalocal systemd-logind[833]: New session 57 of user root. Feb 20 19:11:32 np0005625471.novalocal systemd[1]: Started Session 57 of User root. Feb 20 19:11:32 np0005625471.novalocal sshd-session[68502]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:32 np0005625471.novalocal sshd-session[68505]: Received disconnect from 38.102.83.198 port 34804:11: disconnected by user Feb 20 19:11:32 np0005625471.novalocal sshd-session[68505]: Disconnected from user root 38.102.83.198 port 34804 Feb 20 19:11:32 np0005625471.novalocal sshd-session[68502]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:32 np0005625471.novalocal systemd[1]: session-57.scope: Deactivated successfully. Feb 20 19:11:32 np0005625471.novalocal systemd-logind[833]: Session 57 logged out. Waiting for processes to exit. Feb 20 19:11:32 np0005625471.novalocal systemd-logind[833]: Removed session 57. Feb 20 19:11:34 np0005625471.novalocal groupadd[68535]: group added to /etc/group: name=glance, GID=161 Feb 20 19:11:34 np0005625471.novalocal groupadd[68535]: group added to /etc/gshadow: name=glance Feb 20 19:11:34 np0005625471.novalocal groupadd[68535]: new group: name=glance, GID=161 Feb 20 19:11:34 np0005625471.novalocal useradd[68542]: new user: name=glance, UID=161, GID=161, home=/var/lib/glance, shell=/sbin/nologin, from=none Feb 20 19:11:35 np0005625471.novalocal sshd-session[68564]: Accepted publickey for root from 38.102.83.198 port 34810 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:35 np0005625471.novalocal systemd-logind[833]: New session 58 of user root. Feb 20 19:11:35 np0005625471.novalocal systemd[1]: Started Session 58 of User root. Feb 20 19:11:35 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:11:35 np0005625471.novalocal sshd-session[68564]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:35 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:11:35 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:11:35 np0005625471.novalocal sshd-session[68573]: Received disconnect from 38.102.83.198 port 34810:11: disconnected by user Feb 20 19:11:35 np0005625471.novalocal sshd-session[68573]: Disconnected from user root 38.102.83.198 port 34810 Feb 20 19:11:35 np0005625471.novalocal sshd-session[68564]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:35 np0005625471.novalocal systemd-rc-local-generator[68649]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:11:36 np0005625471.novalocal systemd[1]: session-58.scope: Deactivated successfully. Feb 20 19:11:36 np0005625471.novalocal systemd-logind[833]: Session 58 logged out. Waiting for processes to exit. Feb 20 19:11:36 np0005625471.novalocal systemd-logind[833]: Removed session 58. Feb 20 19:11:36 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:11:38 np0005625471.novalocal sshd-session[71697]: Accepted publickey for root from 38.102.83.198 port 34812 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:38 np0005625471.novalocal systemd-logind[833]: New session 59 of user root. Feb 20 19:11:38 np0005625471.novalocal systemd[1]: Started Session 59 of User root. Feb 20 19:11:38 np0005625471.novalocal sshd-session[71697]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:39 np0005625471.novalocal sshd-session[71746]: Received disconnect from 38.102.83.198 port 34812:11: disconnected by user Feb 20 19:11:39 np0005625471.novalocal sshd-session[71746]: Disconnected from user root 38.102.83.198 port 34812 Feb 20 19:11:39 np0005625471.novalocal sshd-session[71697]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:39 np0005625471.novalocal systemd[1]: session-59.scope: Deactivated successfully. Feb 20 19:11:39 np0005625471.novalocal systemd-logind[833]: Session 59 logged out. Waiting for processes to exit. Feb 20 19:11:39 np0005625471.novalocal systemd-logind[833]: Removed session 59. Feb 20 19:11:42 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:11:42 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:11:42 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Consumed 6.756s CPU time. Feb 20 19:11:42 np0005625471.novalocal systemd[1]: run-rdd0ac48c864841a6a22a2327297541b6.service: Deactivated successfully. Feb 20 19:11:42 np0005625471.novalocal sshd-session[74478]: Accepted publickey for root from 38.102.83.198 port 51024 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:42 np0005625471.novalocal systemd-logind[833]: New session 60 of user root. Feb 20 19:11:42 np0005625471.novalocal systemd[1]: Started Session 60 of User root. Feb 20 19:11:42 np0005625471.novalocal sshd-session[74478]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:42 np0005625471.novalocal sshd-session[74483]: Received disconnect from 38.102.83.198 port 51024:11: disconnected by user Feb 20 19:11:42 np0005625471.novalocal sshd-session[74483]: Disconnected from user root 38.102.83.198 port 51024 Feb 20 19:11:42 np0005625471.novalocal sshd-session[74478]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:42 np0005625471.novalocal systemd[1]: session-60.scope: Deactivated successfully. Feb 20 19:11:42 np0005625471.novalocal systemd-logind[833]: Session 60 logged out. Waiting for processes to exit. Feb 20 19:11:42 np0005625471.novalocal systemd-logind[833]: Removed session 60. Feb 20 19:11:45 np0005625471.novalocal sshd-session[74529]: Accepted publickey for root from 38.102.83.198 port 51038 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:45 np0005625471.novalocal systemd-logind[833]: New session 61 of user root. Feb 20 19:11:45 np0005625471.novalocal systemd[1]: Started Session 61 of User root. Feb 20 19:11:45 np0005625471.novalocal sshd-session[74529]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:45 np0005625471.novalocal sshd-session[74532]: Received disconnect from 38.102.83.198 port 51038:11: disconnected by user Feb 20 19:11:45 np0005625471.novalocal sshd-session[74532]: Disconnected from user root 38.102.83.198 port 51038 Feb 20 19:11:45 np0005625471.novalocal sshd-session[74529]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:45 np0005625471.novalocal systemd[1]: session-61.scope: Deactivated successfully. Feb 20 19:11:45 np0005625471.novalocal systemd-logind[833]: Session 61 logged out. Waiting for processes to exit. Feb 20 19:11:45 np0005625471.novalocal systemd-logind[833]: Removed session 61. Feb 20 19:11:45 np0005625471.novalocal groupadd[74562]: group added to /etc/group: name=placement, GID=987 Feb 20 19:11:45 np0005625471.novalocal groupadd[74562]: group added to /etc/gshadow: name=placement Feb 20 19:11:45 np0005625471.novalocal groupadd[74562]: new group: name=placement, GID=987 Feb 20 19:11:45 np0005625471.novalocal useradd[74569]: new user: name=placement, UID=987, GID=987, home=/, shell=/bin/bash, from=none Feb 20 19:11:48 np0005625471.novalocal sshd-session[74588]: Accepted publickey for root from 38.102.83.198 port 51046 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:48 np0005625471.novalocal systemd-logind[833]: New session 62 of user root. Feb 20 19:11:48 np0005625471.novalocal systemd[1]: Started Session 62 of User root. Feb 20 19:11:48 np0005625471.novalocal sshd-session[74588]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:48 np0005625471.novalocal sshd-session[74591]: Received disconnect from 38.102.83.198 port 51046:11: disconnected by user Feb 20 19:11:48 np0005625471.novalocal sshd-session[74591]: Disconnected from user root 38.102.83.198 port 51046 Feb 20 19:11:48 np0005625471.novalocal sshd-session[74588]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:48 np0005625471.novalocal systemd[1]: session-62.scope: Deactivated successfully. Feb 20 19:11:48 np0005625471.novalocal systemd-logind[833]: Session 62 logged out. Waiting for processes to exit. Feb 20 19:11:48 np0005625471.novalocal systemd-logind[833]: Removed session 62. Feb 20 19:11:51 np0005625471.novalocal sshd-session[74689]: Accepted publickey for root from 38.102.83.198 port 36162 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:51 np0005625471.novalocal systemd-logind[833]: New session 63 of user root. Feb 20 19:11:51 np0005625471.novalocal systemd[1]: Started Session 63 of User root. Feb 20 19:11:51 np0005625471.novalocal sshd-session[74689]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:52 np0005625471.novalocal sshd-session[74696]: Received disconnect from 38.102.83.198 port 36162:11: disconnected by user Feb 20 19:11:52 np0005625471.novalocal sshd-session[74696]: Disconnected from user root 38.102.83.198 port 36162 Feb 20 19:11:52 np0005625471.novalocal sshd-session[74689]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:52 np0005625471.novalocal systemd[1]: session-63.scope: Deactivated successfully. Feb 20 19:11:52 np0005625471.novalocal systemd-logind[833]: Session 63 logged out. Waiting for processes to exit. Feb 20 19:11:52 np0005625471.novalocal systemd-logind[833]: Removed session 63. Feb 20 19:11:53 np0005625471.novalocal groupadd[74735]: group added to /etc/group: name=radvd, GID=75 Feb 20 19:11:53 np0005625471.novalocal groupadd[74735]: group added to /etc/gshadow: name=radvd Feb 20 19:11:53 np0005625471.novalocal groupadd[74735]: new group: name=radvd, GID=75 Feb 20 19:11:53 np0005625471.novalocal useradd[74744]: new user: name=radvd, UID=75, GID=75, home=/, shell=/sbin/nologin, from=none Feb 20 19:11:54 np0005625471.novalocal groupadd[74759]: group added to /etc/group: name=haproxy, GID=986 Feb 20 19:11:54 np0005625471.novalocal groupadd[74759]: group added to /etc/gshadow: name=haproxy Feb 20 19:11:54 np0005625471.novalocal groupadd[74759]: new group: name=haproxy, GID=986 Feb 20 19:11:54 np0005625471.novalocal useradd[74766]: new user: name=haproxy, UID=986, GID=986, home=/var/lib/haproxy, shell=/usr/sbin/nologin, from=none Feb 20 19:11:54 np0005625471.novalocal groupadd[74778]: group added to /etc/group: name=dnsmasq, GID=985 Feb 20 19:11:54 np0005625471.novalocal groupadd[74778]: group added to /etc/gshadow: name=dnsmasq Feb 20 19:11:54 np0005625471.novalocal groupadd[74778]: new group: name=dnsmasq, GID=985 Feb 20 19:11:54 np0005625471.novalocal useradd[74785]: new user: name=dnsmasq, UID=985, GID=985, home=/var/lib/dnsmasq, shell=/usr/sbin/nologin, from=none Feb 20 19:11:54 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:11:54 np0005625471.novalocal dbus-broker-launch[822]: Noticed file-system modification, trigger reload. Feb 20 19:11:54 np0005625471.novalocal groupadd[74797]: group added to /etc/group: name=unbound, GID=984 Feb 20 19:11:54 np0005625471.novalocal groupadd[74797]: group added to /etc/gshadow: name=unbound Feb 20 19:11:54 np0005625471.novalocal groupadd[74797]: new group: name=unbound, GID=984 Feb 20 19:11:54 np0005625471.novalocal useradd[74804]: new user: name=unbound, UID=984, GID=984, home=/var/lib/unbound, shell=/sbin/nologin, from=none Feb 20 19:11:54 np0005625471.novalocal systemd[1]: Started daily update of the root trust anchor for DNSSEC. Feb 20 19:11:55 np0005625471.novalocal sshd-session[74824]: Accepted publickey for root from 38.102.83.198 port 36164 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:55 np0005625471.novalocal systemd-logind[833]: New session 64 of user root. Feb 20 19:11:55 np0005625471.novalocal systemd[1]: Started Session 64 of User root. Feb 20 19:11:55 np0005625471.novalocal sshd-session[74824]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:55 np0005625471.novalocal sshd-session[74827]: Received disconnect from 38.102.83.198 port 36164:11: disconnected by user Feb 20 19:11:55 np0005625471.novalocal sshd-session[74827]: Disconnected from user root 38.102.83.198 port 36164 Feb 20 19:11:55 np0005625471.novalocal sshd-session[74824]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:55 np0005625471.novalocal systemd[1]: session-64.scope: Deactivated successfully. Feb 20 19:11:55 np0005625471.novalocal systemd-logind[833]: Session 64 logged out. Waiting for processes to exit. Feb 20 19:11:55 np0005625471.novalocal systemd-logind[833]: Removed session 64. Feb 20 19:11:58 np0005625471.novalocal sshd-session[74864]: Accepted publickey for root from 38.102.83.198 port 36166 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:11:58 np0005625471.novalocal systemd-logind[833]: New session 65 of user root. Feb 20 19:11:58 np0005625471.novalocal systemd[1]: Started Session 65 of User root. Feb 20 19:11:58 np0005625471.novalocal sshd-session[74864]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:11:58 np0005625471.novalocal sshd-session[74867]: Received disconnect from 38.102.83.198 port 36166:11: disconnected by user Feb 20 19:11:58 np0005625471.novalocal sshd-session[74867]: Disconnected from user root 38.102.83.198 port 36166 Feb 20 19:11:58 np0005625471.novalocal sshd-session[74864]: pam_unix(sshd:session): session closed for user root Feb 20 19:11:58 np0005625471.novalocal systemd[1]: session-65.scope: Deactivated successfully. Feb 20 19:11:58 np0005625471.novalocal systemd-logind[833]: Session 65 logged out. Waiting for processes to exit. Feb 20 19:11:58 np0005625471.novalocal systemd-logind[833]: Removed session 65. Feb 20 19:12:01 np0005625471.novalocal sshd-session[74898]: Accepted publickey for root from 38.102.83.198 port 56558 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:01 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:12:01 np0005625471.novalocal systemd-logind[833]: New session 66 of user root. Feb 20 19:12:01 np0005625471.novalocal systemd[1]: Started Session 66 of User root. Feb 20 19:12:01 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:12:01 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:12:01 np0005625471.novalocal sshd-session[74898]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:01 np0005625471.novalocal sshd-session[74902]: Received disconnect from 38.102.83.198 port 56558:11: disconnected by user Feb 20 19:12:01 np0005625471.novalocal sshd-session[74902]: Disconnected from user root 38.102.83.198 port 56558 Feb 20 19:12:01 np0005625471.novalocal sshd-session[74898]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:01 np0005625471.novalocal systemd-logind[833]: Session 66 logged out. Waiting for processes to exit. Feb 20 19:12:01 np0005625471.novalocal systemd[1]: session-66.scope: Deactivated successfully. Feb 20 19:12:01 np0005625471.novalocal systemd-logind[833]: Removed session 66. Feb 20 19:12:04 np0005625471.novalocal kernel: SELinux: Converting 2762 SID table entries... Feb 20 19:12:04 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:12:04 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:12:04 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:12:04 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:12:04 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:12:04 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:12:04 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:12:04 np0005625471.novalocal groupadd[74938]: group added to /etc/group: name=openvswitch, GID=983 Feb 20 19:12:04 np0005625471.novalocal groupadd[74938]: group added to /etc/gshadow: name=openvswitch Feb 20 19:12:04 np0005625471.novalocal groupadd[74938]: new group: name=openvswitch, GID=983 Feb 20 19:12:04 np0005625471.novalocal useradd[74945]: new user: name=openvswitch, UID=983, GID=983, home=/, shell=/sbin/nologin, from=none Feb 20 19:12:04 np0005625471.novalocal groupadd[74953]: group added to /etc/group: name=hugetlbfs, GID=982 Feb 20 19:12:04 np0005625471.novalocal groupadd[74953]: group added to /etc/gshadow: name=hugetlbfs Feb 20 19:12:04 np0005625471.novalocal groupadd[74953]: new group: name=hugetlbfs, GID=982 Feb 20 19:12:04 np0005625471.novalocal usermod[74961]: add 'openvswitch' to group 'hugetlbfs' Feb 20 19:12:04 np0005625471.novalocal usermod[74961]: add 'openvswitch' to shadow group 'hugetlbfs' Feb 20 19:12:05 np0005625471.novalocal sshd-session[74981]: Accepted publickey for root from 38.102.83.198 port 56574 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:05 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=15 res=1 Feb 20 19:12:05 np0005625471.novalocal systemd-logind[833]: New session 67 of user root. Feb 20 19:12:05 np0005625471.novalocal systemd[1]: Started Session 67 of User root. Feb 20 19:12:05 np0005625471.novalocal sshd-session[74981]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:05 np0005625471.novalocal sshd-session[74984]: Received disconnect from 38.102.83.198 port 56574:11: disconnected by user Feb 20 19:12:05 np0005625471.novalocal sshd-session[74984]: Disconnected from user root 38.102.83.198 port 56574 Feb 20 19:12:05 np0005625471.novalocal sshd-session[74981]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:05 np0005625471.novalocal systemd[1]: session-67.scope: Deactivated successfully. Feb 20 19:12:05 np0005625471.novalocal systemd-logind[833]: Session 67 logged out. Waiting for processes to exit. Feb 20 19:12:05 np0005625471.novalocal systemd-logind[833]: Removed session 67. Feb 20 19:12:08 np0005625471.novalocal sshd-session[75015]: Accepted publickey for root from 38.102.83.198 port 56578 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:08 np0005625471.novalocal systemd-logind[833]: New session 68 of user root. Feb 20 19:12:08 np0005625471.novalocal systemd[1]: Started Session 68 of User root. Feb 20 19:12:08 np0005625471.novalocal sshd-session[75015]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:08 np0005625471.novalocal groupadd[75021]: group added to /etc/group: name=neutron, GID=981 Feb 20 19:12:08 np0005625471.novalocal groupadd[75021]: group added to /etc/gshadow: name=neutron Feb 20 19:12:08 np0005625471.novalocal groupadd[75021]: new group: name=neutron, GID=981 Feb 20 19:12:08 np0005625471.novalocal useradd[75036]: new user: name=neutron, UID=982, GID=981, home=/var/lib/neutron, shell=/sbin/nologin, from=none Feb 20 19:12:08 np0005625471.novalocal sshd-session[75018]: Received disconnect from 38.102.83.198 port 56578:11: disconnected by user Feb 20 19:12:08 np0005625471.novalocal sshd-session[75018]: Disconnected from user root 38.102.83.198 port 56578 Feb 20 19:12:08 np0005625471.novalocal sshd-session[75015]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:08 np0005625471.novalocal systemd[1]: session-68.scope: Deactivated successfully. Feb 20 19:12:08 np0005625471.novalocal systemd-logind[833]: Session 68 logged out. Waiting for processes to exit. Feb 20 19:12:08 np0005625471.novalocal systemd-logind[833]: Removed session 68. Feb 20 19:12:09 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:12:09 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:12:09 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:12:09 np0005625471.novalocal systemd-rc-local-generator[75564]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:12:09 np0005625471.novalocal systemd-sysv-generator[75567]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:12:10 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:12:10 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:12:10 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:12:10 np0005625471.novalocal systemd[1]: run-rb98406ec9fe642e99a08f88c7b3b6f3f.service: Deactivated successfully. Feb 20 19:12:11 np0005625471.novalocal sshd-session[76111]: Accepted publickey for root from 38.102.83.198 port 47380 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:11 np0005625471.novalocal systemd-logind[833]: New session 69 of user root. Feb 20 19:12:11 np0005625471.novalocal systemd[1]: Started Session 69 of User root. Feb 20 19:12:11 np0005625471.novalocal sshd-session[76111]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:11 np0005625471.novalocal sshd-session[76114]: Received disconnect from 38.102.83.198 port 47380:11: disconnected by user Feb 20 19:12:11 np0005625471.novalocal sshd-session[76114]: Disconnected from user root 38.102.83.198 port 47380 Feb 20 19:12:11 np0005625471.novalocal sshd-session[76111]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:11 np0005625471.novalocal systemd[1]: session-69.scope: Deactivated successfully. Feb 20 19:12:11 np0005625471.novalocal systemd-logind[833]: Session 69 logged out. Waiting for processes to exit. Feb 20 19:12:11 np0005625471.novalocal systemd-logind[833]: Removed session 69. Feb 20 19:12:14 np0005625471.novalocal sshd-session[76159]: Accepted publickey for root from 38.102.83.198 port 47384 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:14 np0005625471.novalocal systemd-logind[833]: New session 70 of user root. Feb 20 19:12:14 np0005625471.novalocal systemd[1]: Started Session 70 of User root. Feb 20 19:12:14 np0005625471.novalocal sshd-session[76159]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:14 np0005625471.novalocal sshd-session[76162]: Received disconnect from 38.102.83.198 port 47384:11: disconnected by user Feb 20 19:12:14 np0005625471.novalocal sshd-session[76162]: Disconnected from user root 38.102.83.198 port 47384 Feb 20 19:12:14 np0005625471.novalocal sshd-session[76159]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:14 np0005625471.novalocal systemd[1]: session-70.scope: Deactivated successfully. Feb 20 19:12:14 np0005625471.novalocal systemd-logind[833]: Session 70 logged out. Waiting for processes to exit. Feb 20 19:12:14 np0005625471.novalocal systemd-logind[833]: Removed session 70. Feb 20 19:12:16 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:12:16 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:12:17 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:12:17 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:12:17 np0005625471.novalocal systemd[1]: run-r567667f35e304be4aaad4dca3cd79cec.service: Deactivated successfully. Feb 20 19:12:18 np0005625471.novalocal sshd-session[76353]: Accepted publickey for root from 38.102.83.198 port 47398 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:18 np0005625471.novalocal systemd-logind[833]: New session 71 of user root. Feb 20 19:12:18 np0005625471.novalocal systemd[1]: Started Session 71 of User root. Feb 20 19:12:18 np0005625471.novalocal sshd-session[76353]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:18 np0005625471.novalocal sshd-session[76356]: Received disconnect from 38.102.83.198 port 47398:11: disconnected by user Feb 20 19:12:18 np0005625471.novalocal sshd-session[76356]: Disconnected from user root 38.102.83.198 port 47398 Feb 20 19:12:18 np0005625471.novalocal sshd-session[76353]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:18 np0005625471.novalocal systemd[1]: session-71.scope: Deactivated successfully. Feb 20 19:12:18 np0005625471.novalocal systemd-logind[833]: Session 71 logged out. Waiting for processes to exit. Feb 20 19:12:18 np0005625471.novalocal systemd-logind[833]: Removed session 71. Feb 20 19:12:20 np0005625471.novalocal groupadd[76400]: group added to /etc/group: name=swift, GID=160 Feb 20 19:12:20 np0005625471.novalocal groupadd[76400]: group added to /etc/gshadow: name=swift Feb 20 19:12:20 np0005625471.novalocal groupadd[76400]: new group: name=swift, GID=160 Feb 20 19:12:20 np0005625471.novalocal useradd[76407]: new user: name=swift, UID=160, GID=160, home=/var/lib/swift, shell=/sbin/nologin, from=none Feb 20 19:12:21 np0005625471.novalocal sshd-session[76417]: Accepted publickey for root from 38.102.83.198 port 35040 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:21 np0005625471.novalocal systemd-logind[833]: New session 72 of user root. Feb 20 19:12:21 np0005625471.novalocal systemd[1]: Started Session 72 of User root. Feb 20 19:12:21 np0005625471.novalocal sshd-session[76417]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:21 np0005625471.novalocal sshd-session[76424]: Received disconnect from 38.102.83.198 port 35040:11: disconnected by user Feb 20 19:12:21 np0005625471.novalocal sshd-session[76424]: Disconnected from user root 38.102.83.198 port 35040 Feb 20 19:12:21 np0005625471.novalocal sshd-session[76417]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:21 np0005625471.novalocal systemd[1]: session-72.scope: Deactivated successfully. Feb 20 19:12:21 np0005625471.novalocal systemd-logind[833]: Session 72 logged out. Waiting for processes to exit. Feb 20 19:12:21 np0005625471.novalocal systemd-logind[833]: Removed session 72. Feb 20 19:12:21 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:12:21 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:12:22 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:12:22 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:12:22 np0005625471.novalocal systemd[1]: run-rf6bbd2566f3a4d70bfacdf42097322e2.service: Deactivated successfully. Feb 20 19:12:24 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:12:24 np0005625471.novalocal systemd-rc-local-generator[76721]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:12:24 np0005625471.novalocal systemd-sysv-generator[76724]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:12:24 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:12:24 np0005625471.novalocal sshd-session[76742]: Accepted publickey for root from 38.102.83.198 port 35050 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:24 np0005625471.novalocal systemd-logind[833]: New session 73 of user root. Feb 20 19:12:24 np0005625471.novalocal systemd[1]: Started Session 73 of User root. Feb 20 19:12:24 np0005625471.novalocal sshd-session[76742]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:24 np0005625471.novalocal sshd-session[76746]: Received disconnect from 38.102.83.198 port 35050:11: disconnected by user Feb 20 19:12:24 np0005625471.novalocal sshd-session[76746]: Disconnected from user root 38.102.83.198 port 35050 Feb 20 19:12:24 np0005625471.novalocal sshd-session[76742]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:24 np0005625471.novalocal systemd[1]: session-73.scope: Deactivated successfully. Feb 20 19:12:24 np0005625471.novalocal systemd-logind[833]: Session 73 logged out. Waiting for processes to exit. Feb 20 19:12:24 np0005625471.novalocal systemd-logind[833]: Removed session 73. Feb 20 19:12:26 np0005625471.novalocal kernel: SELinux: Converting 2766 SID table entries... Feb 20 19:12:26 np0005625471.novalocal kernel: SELinux: policy capability network_peer_controls=1 Feb 20 19:12:26 np0005625471.novalocal kernel: SELinux: policy capability open_perms=1 Feb 20 19:12:26 np0005625471.novalocal kernel: SELinux: policy capability extended_socket_class=1 Feb 20 19:12:26 np0005625471.novalocal kernel: SELinux: policy capability always_check_network=0 Feb 20 19:12:26 np0005625471.novalocal kernel: SELinux: policy capability cgroup_seclabel=1 Feb 20 19:12:26 np0005625471.novalocal kernel: SELinux: policy capability nnp_nosuid_transition=1 Feb 20 19:12:26 np0005625471.novalocal kernel: SELinux: policy capability genfs_seclabel_symlinks=1 Feb 20 19:12:26 np0005625471.novalocal setsebool[76776]: The rsync_export_all_ro policy boolean was changed to on by root Feb 20 19:12:26 np0005625471.novalocal dbus-broker-launch[823]: avc: op=load_policy lsm=selinux seqno=17 res=1 Feb 20 19:12:26 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:12:26 np0005625471.novalocal systemd-sysv-generator[76808]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:12:26 np0005625471.novalocal systemd-rc-local-generator[76805]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:12:26 np0005625471.novalocal systemd[1]: Started memcached daemon. Feb 20 19:12:26 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:12:26 np0005625471.novalocal systemd-rc-local-generator[76854]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:12:26 np0005625471.novalocal systemd-sysv-generator[76859]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:12:26 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:12:27 np0005625471.novalocal systemd-rc-local-generator[76895]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:12:27 np0005625471.novalocal systemd-sysv-generator[76898]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:12:27 np0005625471.novalocal sshd-session[76917]: Accepted publickey for root from 38.102.83.198 port 35060 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:27 np0005625471.novalocal systemd-logind[833]: New session 74 of user root. Feb 20 19:12:27 np0005625471.novalocal systemd[1]: Started Session 74 of User root. Feb 20 19:12:27 np0005625471.novalocal sshd-session[76917]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:27 np0005625471.novalocal sshd-session[76920]: Received disconnect from 38.102.83.198 port 35060:11: disconnected by user Feb 20 19:12:27 np0005625471.novalocal sshd-session[76920]: Disconnected from user root 38.102.83.198 port 35060 Feb 20 19:12:27 np0005625471.novalocal sshd-session[76917]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:27 np0005625471.novalocal systemd[1]: session-74.scope: Deactivated successfully. Feb 20 19:12:28 np0005625471.novalocal systemd-logind[833]: Session 74 logged out. Waiting for processes to exit. Feb 20 19:12:28 np0005625471.novalocal systemd-logind[833]: Removed session 74. Feb 20 19:12:29 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:12:29 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:12:29 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:12:29 np0005625471.novalocal systemd-rc-local-generator[76984]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:12:29 np0005625471.novalocal systemd-sysv-generator[76989]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:12:29 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:12:30 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:12:30 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:12:31 np0005625471.novalocal systemd[1]: run-re0ae1de0a715408b94e55067b31e9165.service: Deactivated successfully. Feb 20 19:12:31 np0005625471.novalocal sshd-session[77199]: Accepted publickey for root from 38.102.83.198 port 51632 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:31 np0005625471.novalocal systemd-logind[833]: New session 75 of user root. Feb 20 19:12:31 np0005625471.novalocal systemd[1]: Started Session 75 of User root. Feb 20 19:12:31 np0005625471.novalocal sshd-session[77199]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:31 np0005625471.novalocal sshd-session[77202]: Received disconnect from 38.102.83.198 port 51632:11: disconnected by user Feb 20 19:12:31 np0005625471.novalocal sshd-session[77202]: Disconnected from user root 38.102.83.198 port 51632 Feb 20 19:12:31 np0005625471.novalocal sshd-session[77199]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:31 np0005625471.novalocal systemd[1]: session-75.scope: Deactivated successfully. Feb 20 19:12:31 np0005625471.novalocal systemd-logind[833]: Session 75 logged out. Waiting for processes to exit. Feb 20 19:12:31 np0005625471.novalocal systemd-logind[833]: Removed session 75. Feb 20 19:12:34 np0005625471.novalocal sshd-session[77246]: Accepted publickey for root from 38.102.83.198 port 51634 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:34 np0005625471.novalocal systemd-logind[833]: New session 76 of user root. Feb 20 19:12:34 np0005625471.novalocal systemd[1]: Started Session 76 of User root. Feb 20 19:12:34 np0005625471.novalocal sshd-session[77246]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:34 np0005625471.novalocal sshd-session[77249]: Received disconnect from 38.102.83.198 port 51634:11: disconnected by user Feb 20 19:12:34 np0005625471.novalocal sshd-session[77249]: Disconnected from user root 38.102.83.198 port 51634 Feb 20 19:12:34 np0005625471.novalocal sshd-session[77246]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:34 np0005625471.novalocal systemd[1]: session-76.scope: Deactivated successfully. Feb 20 19:12:34 np0005625471.novalocal systemd-logind[833]: Session 76 logged out. Waiting for processes to exit. Feb 20 19:12:34 np0005625471.novalocal systemd-logind[833]: Removed session 76. Feb 20 19:12:37 np0005625471.novalocal sshd-session[77287]: Accepted publickey for root from 38.102.83.198 port 51642 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:37 np0005625471.novalocal systemd-logind[833]: New session 77 of user root. Feb 20 19:12:37 np0005625471.novalocal systemd[1]: Started Session 77 of User root. Feb 20 19:12:37 np0005625471.novalocal sshd-session[77287]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:37 np0005625471.novalocal sshd-session[77290]: Received disconnect from 38.102.83.198 port 51642:11: disconnected by user Feb 20 19:12:37 np0005625471.novalocal sshd-session[77290]: Disconnected from user root 38.102.83.198 port 51642 Feb 20 19:12:37 np0005625471.novalocal sshd-session[77287]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:37 np0005625471.novalocal systemd[1]: session-77.scope: Deactivated successfully. Feb 20 19:12:37 np0005625471.novalocal systemd-logind[833]: Session 77 logged out. Waiting for processes to exit. Feb 20 19:12:37 np0005625471.novalocal systemd-logind[833]: Removed session 77. Feb 20 19:12:40 np0005625471.novalocal sshd-session[77347]: Accepted publickey for root from 38.102.83.198 port 59966 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:40 np0005625471.novalocal systemd-logind[833]: New session 78 of user root. Feb 20 19:12:40 np0005625471.novalocal systemd[1]: Started Session 78 of User root. Feb 20 19:12:40 np0005625471.novalocal sshd-session[77347]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:40 np0005625471.novalocal sshd-session[77350]: Received disconnect from 38.102.83.198 port 59966:11: disconnected by user Feb 20 19:12:40 np0005625471.novalocal sshd-session[77350]: Disconnected from user root 38.102.83.198 port 59966 Feb 20 19:12:40 np0005625471.novalocal sshd-session[77347]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:40 np0005625471.novalocal systemd[1]: session-78.scope: Deactivated successfully. Feb 20 19:12:40 np0005625471.novalocal systemd-logind[833]: Session 78 logged out. Waiting for processes to exit. Feb 20 19:12:40 np0005625471.novalocal systemd-logind[833]: Removed session 78. Feb 20 19:12:43 np0005625471.novalocal groupadd[77380]: group added to /etc/group: name=trove, GID=980 Feb 20 19:12:43 np0005625471.novalocal groupadd[77380]: group added to /etc/gshadow: name=trove Feb 20 19:12:43 np0005625471.novalocal groupadd[77380]: new group: name=trove, GID=980 Feb 20 19:12:43 np0005625471.novalocal useradd[77387]: new user: name=trove, UID=981, GID=980, home=/var/lib/trove, shell=/sbin/nologin, from=none Feb 20 19:12:43 np0005625471.novalocal useradd[77387]: add 'trove' to group 'trove' Feb 20 19:12:43 np0005625471.novalocal useradd[77387]: add 'trove' to shadow group 'trove' Feb 20 19:12:43 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:12:43 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:12:43 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:12:43 np0005625471.novalocal systemd-sysv-generator[77430]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:12:43 np0005625471.novalocal systemd-rc-local-generator[77427]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:12:43 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:12:44 np0005625471.novalocal sshd-session[77774]: Accepted publickey for root from 38.102.83.198 port 59972 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:44 np0005625471.novalocal systemd-logind[833]: New session 79 of user root. Feb 20 19:12:44 np0005625471.novalocal systemd[1]: Started Session 79 of User root. Feb 20 19:12:44 np0005625471.novalocal sshd-session[77774]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:44 np0005625471.novalocal sshd-session[77893]: Received disconnect from 38.102.83.198 port 59972:11: disconnected by user Feb 20 19:12:44 np0005625471.novalocal sshd-session[77893]: Disconnected from user root 38.102.83.198 port 59972 Feb 20 19:12:44 np0005625471.novalocal sshd-session[77774]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:44 np0005625471.novalocal systemd[1]: session-79.scope: Deactivated successfully. Feb 20 19:12:44 np0005625471.novalocal systemd-logind[833]: Session 79 logged out. Waiting for processes to exit. Feb 20 19:12:44 np0005625471.novalocal systemd-logind[833]: Removed session 79. Feb 20 19:12:44 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:12:44 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:12:44 np0005625471.novalocal systemd[1]: run-r743e886ea0f04fcfa2b8dc34c784aef0.service: Deactivated successfully. Feb 20 19:12:47 np0005625471.novalocal sshd-session[77985]: Accepted publickey for root from 38.102.83.198 port 59984 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:47 np0005625471.novalocal systemd-logind[833]: New session 80 of user root. Feb 20 19:12:47 np0005625471.novalocal systemd[1]: Started Session 80 of User root. Feb 20 19:12:47 np0005625471.novalocal sshd-session[77985]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:47 np0005625471.novalocal sshd-session[77988]: Received disconnect from 38.102.83.198 port 59984:11: disconnected by user Feb 20 19:12:47 np0005625471.novalocal sshd-session[77988]: Disconnected from user root 38.102.83.198 port 59984 Feb 20 19:12:47 np0005625471.novalocal sshd-session[77985]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:47 np0005625471.novalocal systemd[1]: session-80.scope: Deactivated successfully. Feb 20 19:12:47 np0005625471.novalocal systemd-logind[833]: Session 80 logged out. Waiting for processes to exit. Feb 20 19:12:47 np0005625471.novalocal systemd-logind[833]: Removed session 80. Feb 20 19:12:49 np0005625471.novalocal groupadd[78063]: group added to /etc/group: name=epmd, GID=979 Feb 20 19:12:49 np0005625471.novalocal groupadd[78063]: group added to /etc/gshadow: name=epmd Feb 20 19:12:49 np0005625471.novalocal groupadd[78063]: new group: name=epmd, GID=979 Feb 20 19:12:49 np0005625471.novalocal useradd[78070]: new user: name=epmd, UID=980, GID=979, home=/dev/null, shell=/sbin/nologin, from=none Feb 20 19:12:50 np0005625471.novalocal groupadd[78079]: group added to /etc/group: name=rabbitmq, GID=978 Feb 20 19:12:50 np0005625471.novalocal groupadd[78079]: group added to /etc/gshadow: name=rabbitmq Feb 20 19:12:50 np0005625471.novalocal groupadd[78079]: new group: name=rabbitmq, GID=978 Feb 20 19:12:50 np0005625471.novalocal useradd[78086]: new user: name=rabbitmq, UID=979, GID=978, home=/var/lib/rabbitmq, shell=/sbin/nologin, from=none Feb 20 19:12:50 np0005625471.novalocal sshd-session[78096]: Accepted publickey for root from 38.102.83.198 port 36446 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:50 np0005625471.novalocal systemd-logind[833]: New session 81 of user root. Feb 20 19:12:50 np0005625471.novalocal systemd[1]: Started Session 81 of User root. Feb 20 19:12:50 np0005625471.novalocal sshd-session[78096]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:50 np0005625471.novalocal sshd-session[78099]: Received disconnect from 38.102.83.198 port 36446:11: disconnected by user Feb 20 19:12:50 np0005625471.novalocal sshd-session[78099]: Disconnected from user root 38.102.83.198 port 36446 Feb 20 19:12:50 np0005625471.novalocal sshd-session[78096]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:50 np0005625471.novalocal systemd-logind[833]: Session 81 logged out. Waiting for processes to exit. Feb 20 19:12:50 np0005625471.novalocal systemd[1]: session-81.scope: Deactivated successfully. Feb 20 19:12:50 np0005625471.novalocal systemd-logind[833]: Removed session 81. Feb 20 19:12:51 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:12:51 np0005625471.novalocal systemd-sysv-generator[78151]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:12:51 np0005625471.novalocal systemd-rc-local-generator[78148]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:12:52 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:12:52 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:12:52 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:12:52 np0005625471.novalocal systemd-rc-local-generator[78195]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:12:52 np0005625471.novalocal systemd-sysv-generator[78200]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:12:52 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:12:52 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:12:52 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:12:52 np0005625471.novalocal systemd[1]: run-r30a24c6730d642219b064641bc82fe23.service: Deactivated successfully. Feb 20 19:12:53 np0005625471.novalocal systemd[1]: proc-sys-fs-binfmt_misc.automount: Got automount request for /proc/sys/fs/binfmt_misc, triggered by 78665 (sysctl) Feb 20 19:12:53 np0005625471.novalocal systemd[1]: Mounting Arbitrary Executable File Formats File System... Feb 20 19:12:53 np0005625471.novalocal systemd[1]: Mounted Arbitrary Executable File Formats File System. Feb 20 19:12:53 np0005625471.novalocal sshd-session[78679]: Accepted publickey for root from 38.102.83.198 port 36448 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:53 np0005625471.novalocal systemd-logind[833]: New session 82 of user root. Feb 20 19:12:53 np0005625471.novalocal systemd[1]: Started Session 82 of User root. Feb 20 19:12:53 np0005625471.novalocal sshd-session[78679]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:54 np0005625471.novalocal sshd-session[78702]: Received disconnect from 38.102.83.198 port 36448:11: disconnected by user Feb 20 19:12:54 np0005625471.novalocal sshd-session[78702]: Disconnected from user root 38.102.83.198 port 36448 Feb 20 19:12:54 np0005625471.novalocal sshd-session[78679]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:54 np0005625471.novalocal systemd[1]: session-82.scope: Deactivated successfully. Feb 20 19:12:54 np0005625471.novalocal systemd-logind[833]: Session 82 logged out. Waiting for processes to exit. Feb 20 19:12:54 np0005625471.novalocal systemd-logind[833]: Removed session 82. Feb 20 19:12:57 np0005625471.novalocal sshd-session[78782]: Accepted publickey for root from 38.102.83.198 port 36460 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:12:57 np0005625471.novalocal systemd-logind[833]: New session 83 of user root. Feb 20 19:12:57 np0005625471.novalocal systemd[1]: Started Session 83 of User root. Feb 20 19:12:57 np0005625471.novalocal sshd-session[78782]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:12:57 np0005625471.novalocal sshd-session[78785]: Received disconnect from 38.102.83.198 port 36460:11: disconnected by user Feb 20 19:12:57 np0005625471.novalocal sshd-session[78785]: Disconnected from user root 38.102.83.198 port 36460 Feb 20 19:12:57 np0005625471.novalocal sshd-session[78782]: pam_unix(sshd:session): session closed for user root Feb 20 19:12:57 np0005625471.novalocal systemd-logind[833]: Session 83 logged out. Waiting for processes to exit. Feb 20 19:12:57 np0005625471.novalocal systemd[1]: session-83.scope: Deactivated successfully. Feb 20 19:12:57 np0005625471.novalocal systemd-logind[833]: Removed session 83. Feb 20 19:13:00 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:13:00 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:13:00 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:13:00 np0005625471.novalocal groupadd[78849]: group added to /etc/group: name=nova, GID=162 Feb 20 19:13:00 np0005625471.novalocal groupadd[78849]: group added to /etc/gshadow: name=nova Feb 20 19:13:00 np0005625471.novalocal groupadd[78849]: new group: name=nova, GID=162 Feb 20 19:13:00 np0005625471.novalocal useradd[78856]: new user: name=nova, UID=162, GID=162, home=/var/lib/nova, shell=/sbin/nologin, from=none Feb 20 19:13:00 np0005625471.novalocal useradd[78856]: add 'nova' to group 'nobody' Feb 20 19:13:00 np0005625471.novalocal useradd[78856]: add 'nova' to group 'nova' Feb 20 19:13:00 np0005625471.novalocal useradd[78856]: add 'nova' to shadow group 'nobody' Feb 20 19:13:00 np0005625471.novalocal useradd[78856]: add 'nova' to shadow group 'nova' Feb 20 19:13:00 np0005625471.novalocal sshd-session[78860]: Accepted publickey for root from 38.102.83.198 port 57318 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:00 np0005625471.novalocal systemd-logind[833]: New session 84 of user root. Feb 20 19:13:00 np0005625471.novalocal systemd[1]: Started Session 84 of User root. Feb 20 19:13:00 np0005625471.novalocal sshd-session[78860]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:00 np0005625471.novalocal sshd-session[78870]: Received disconnect from 38.102.83.198 port 57318:11: disconnected by user Feb 20 19:13:00 np0005625471.novalocal sshd-session[78870]: Disconnected from user root 38.102.83.198 port 57318 Feb 20 19:13:00 np0005625471.novalocal sshd-session[78860]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:00 np0005625471.novalocal systemd[1]: session-84.scope: Deactivated successfully. Feb 20 19:13:00 np0005625471.novalocal systemd-logind[833]: Session 84 logged out. Waiting for processes to exit. Feb 20 19:13:00 np0005625471.novalocal systemd-logind[833]: Removed session 84. Feb 20 19:13:00 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:13:00 np0005625471.novalocal systemd-sysv-generator[78930]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:13:00 np0005625471.novalocal systemd-rc-local-generator[78925]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:13:00 np0005625471.novalocal systemd[1]: Starting dnf makecache... Feb 20 19:13:00 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: Updating Subscription Management repositories. Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: Unable to read consumer identity Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: This system is not registered with an entitlement server. You can use subscription-manager to register. Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: Failed determining last makecache time. Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: CentOS-9-stream - Ceph Quincy 84 kB/s | 11 kB 00:00 Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: CentOS-9 - RabbitMQ 38 72 kB/s | 8.0 kB 00:00 Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: CentOS Stream 9 - NFV OpenvSwitch 65 kB/s | 7.5 kB 00:00 Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: CentOS-9 - OpenStack antelope 78 kB/s | 8.1 kB 00:00 Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: CentOS Stream 9 - BaseOS 454 kB/s | 3.9 kB 00:00 Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: CentOS Stream 9 - AppStream 1.2 MB/s | 4.4 kB 00:00 Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: CentOS Stream 9 - CRB 1.1 MB/s | 4.3 kB 00:00 Feb 20 19:13:01 np0005625471.novalocal dnf[78940]: CentOS Stream 9 - Extras packages 786 kB/s | 3.0 kB 00:00 Feb 20 19:13:02 np0005625471.novalocal dnf[78940]: Extra Packages for Enterprise Linux 9 - x86_64 240 kB/s | 31 kB 00:00 Feb 20 19:13:02 np0005625471.novalocal dnf[78940]: Metadata cache created. Feb 20 19:13:02 np0005625471.novalocal systemd[1]: dnf-makecache.service: Deactivated successfully. Feb 20 19:13:02 np0005625471.novalocal systemd[1]: Finished dnf makecache. Feb 20 19:13:02 np0005625471.novalocal systemd[1]: dnf-makecache.service: Consumed 1.104s CPU time. Feb 20 19:13:03 np0005625471.novalocal sshd-session[78956]: Accepted publickey for root from 38.102.83.198 port 57334 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:03 np0005625471.novalocal systemd-logind[833]: New session 85 of user root. Feb 20 19:13:03 np0005625471.novalocal systemd[1]: Started Session 85 of User root. Feb 20 19:13:03 np0005625471.novalocal sshd-session[78956]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:03 np0005625471.novalocal sshd-session[78959]: Received disconnect from 38.102.83.198 port 57334:11: disconnected by user Feb 20 19:13:03 np0005625471.novalocal sshd-session[78959]: Disconnected from user root 38.102.83.198 port 57334 Feb 20 19:13:03 np0005625471.novalocal sshd-session[78956]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:03 np0005625471.novalocal systemd[1]: session-85.scope: Deactivated successfully. Feb 20 19:13:03 np0005625471.novalocal systemd-logind[833]: Session 85 logged out. Waiting for processes to exit. Feb 20 19:13:03 np0005625471.novalocal systemd-logind[833]: Removed session 85. Feb 20 19:13:05 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:13:05 np0005625471.novalocal systemd-rc-local-generator[79013]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:13:05 np0005625471.novalocal systemd-sysv-generator[79017]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:13:06 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:13:06 np0005625471.novalocal sshd-session[79039]: Accepted publickey for root from 38.102.83.198 port 57338 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:06 np0005625471.novalocal systemd-logind[833]: New session 86 of user root. Feb 20 19:13:06 np0005625471.novalocal systemd[1]: Started Session 86 of User root. Feb 20 19:13:06 np0005625471.novalocal sshd-session[79039]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:07 np0005625471.novalocal sshd-session[79042]: Received disconnect from 38.102.83.198 port 57338:11: disconnected by user Feb 20 19:13:07 np0005625471.novalocal sshd-session[79042]: Disconnected from user root 38.102.83.198 port 57338 Feb 20 19:13:07 np0005625471.novalocal sshd-session[79039]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:07 np0005625471.novalocal systemd[1]: session-86.scope: Deactivated successfully. Feb 20 19:13:07 np0005625471.novalocal systemd-logind[833]: Session 86 logged out. Waiting for processes to exit. Feb 20 19:13:07 np0005625471.novalocal systemd-logind[833]: Removed session 86. Feb 20 19:13:08 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:13:08 np0005625471.novalocal systemd-rc-local-generator[79096]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:13:08 np0005625471.novalocal systemd-sysv-generator[79100]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:13:08 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:13:10 np0005625471.novalocal sshd-session[79122]: Accepted publickey for root from 38.102.83.198 port 44262 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:10 np0005625471.novalocal systemd-logind[833]: New session 87 of user root. Feb 20 19:13:10 np0005625471.novalocal systemd[1]: Started Session 87 of User root. Feb 20 19:13:10 np0005625471.novalocal sshd-session[79122]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:10 np0005625471.novalocal sshd-session[79126]: Received disconnect from 38.102.83.198 port 44262:11: disconnected by user Feb 20 19:13:10 np0005625471.novalocal sshd-session[79126]: Disconnected from user root 38.102.83.198 port 44262 Feb 20 19:13:10 np0005625471.novalocal sshd-session[79122]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:10 np0005625471.novalocal systemd-logind[833]: Session 87 logged out. Waiting for processes to exit. Feb 20 19:13:10 np0005625471.novalocal systemd[1]: session-87.scope: Deactivated successfully. Feb 20 19:13:10 np0005625471.novalocal systemd-logind[833]: Removed session 87. Feb 20 19:13:11 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:13:11 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:13:11 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:13:11 np0005625471.novalocal systemd-rc-local-generator[79188]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:13:11 np0005625471.novalocal systemd-sysv-generator[79192]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:13:11 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:13:11 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:13:11 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:13:11 np0005625471.novalocal systemd[1]: run-r74f91613f6f94252b96d5654d30ac2ae.service: Deactivated successfully. Feb 20 19:13:13 np0005625471.novalocal sshd-session[79361]: Accepted publickey for root from 38.102.83.198 port 44278 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:13 np0005625471.novalocal systemd-logind[833]: New session 88 of user root. Feb 20 19:13:13 np0005625471.novalocal systemd[1]: Started Session 88 of User root. Feb 20 19:13:13 np0005625471.novalocal sshd-session[79361]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:13 np0005625471.novalocal sshd-session[79364]: Received disconnect from 38.102.83.198 port 44278:11: disconnected by user Feb 20 19:13:13 np0005625471.novalocal sshd-session[79364]: Disconnected from user root 38.102.83.198 port 44278 Feb 20 19:13:13 np0005625471.novalocal sshd-session[79361]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:13 np0005625471.novalocal systemd[1]: session-88.scope: Deactivated successfully. Feb 20 19:13:13 np0005625471.novalocal systemd-logind[833]: Session 88 logged out. Waiting for processes to exit. Feb 20 19:13:13 np0005625471.novalocal systemd-logind[833]: Removed session 88. Feb 20 19:13:15 np0005625471.novalocal groupadd[79406]: group added to /etc/group: name=apache, GID=48 Feb 20 19:13:15 np0005625471.novalocal groupadd[79406]: group added to /etc/gshadow: name=apache Feb 20 19:13:15 np0005625471.novalocal groupadd[79406]: new group: name=apache, GID=48 Feb 20 19:13:15 np0005625471.novalocal useradd[79415]: new user: name=apache, UID=48, GID=48, home=/usr/share/httpd, shell=/sbin/nologin, from=none Feb 20 19:13:16 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:13:16 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:13:16 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:13:16 np0005625471.novalocal systemd-sysv-generator[79459]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:13:16 np0005625471.novalocal systemd-rc-local-generator[79455]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:13:16 np0005625471.novalocal sshd-session[79478]: Accepted publickey for root from 38.102.83.198 port 44294 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:16 np0005625471.novalocal systemd-logind[833]: New session 89 of user root. Feb 20 19:13:16 np0005625471.novalocal systemd[1]: Started Session 89 of User root. Feb 20 19:13:16 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:13:16 np0005625471.novalocal sshd-session[79478]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:17 np0005625471.novalocal sshd-session[79586]: Received disconnect from 38.102.83.198 port 44294:11: disconnected by user Feb 20 19:13:17 np0005625471.novalocal sshd-session[79586]: Disconnected from user root 38.102.83.198 port 44294 Feb 20 19:13:17 np0005625471.novalocal sshd-session[79478]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:17 np0005625471.novalocal systemd[1]: session-89.scope: Deactivated successfully. Feb 20 19:13:17 np0005625471.novalocal systemd-logind[833]: Session 89 logged out. Waiting for processes to exit. Feb 20 19:13:17 np0005625471.novalocal systemd-logind[833]: Removed session 89. Feb 20 19:13:17 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:13:17 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:13:17 np0005625471.novalocal systemd[1]: run-rbca9d961b24f4faf963e6dcf2a016a97.service: Deactivated successfully. Feb 20 19:13:20 np0005625471.novalocal sshd-session[79845]: Accepted publickey for root from 38.102.83.198 port 44414 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:20 np0005625471.novalocal systemd-logind[833]: New session 90 of user root. Feb 20 19:13:20 np0005625471.novalocal systemd[1]: Started Session 90 of User root. Feb 20 19:13:20 np0005625471.novalocal sshd-session[79845]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:20 np0005625471.novalocal sshd-session[79848]: Received disconnect from 38.102.83.198 port 44414:11: disconnected by user Feb 20 19:13:20 np0005625471.novalocal sshd-session[79848]: Disconnected from user root 38.102.83.198 port 44414 Feb 20 19:13:20 np0005625471.novalocal sshd-session[79845]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:20 np0005625471.novalocal systemd[1]: session-90.scope: Deactivated successfully. Feb 20 19:13:20 np0005625471.novalocal systemd-logind[833]: Session 90 logged out. Waiting for processes to exit. Feb 20 19:13:20 np0005625471.novalocal systemd-logind[833]: Removed session 90. Feb 20 19:13:20 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:13:20 np0005625471.novalocal systemd-sysv-generator[79900]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:13:20 np0005625471.novalocal systemd-rc-local-generator[79896]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:13:21 np0005625471.novalocal systemd[1]: Started fast remote file copy program daemon. Feb 20 19:13:21 np0005625471.novalocal rsyncd[79916]: rsyncd version 3.2.5 starting, listening on port 873 Feb 20 19:13:21 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:13:21 np0005625471.novalocal systemd-rc-local-generator[79936]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:13:21 np0005625471.novalocal systemd-sysv-generator[79941]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:13:21 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:13:21 np0005625471.novalocal systemd-rc-local-generator[79972]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:13:21 np0005625471.novalocal systemd-sysv-generator[79977]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:13:23 np0005625471.novalocal sshd-session[80067]: Accepted publickey for root from 38.102.83.198 port 44418 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:23 np0005625471.novalocal systemd-logind[833]: New session 91 of user root. Feb 20 19:13:23 np0005625471.novalocal systemd[1]: Started Session 91 of User root. Feb 20 19:13:23 np0005625471.novalocal sshd-session[80067]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:23 np0005625471.novalocal sshd-session[80070]: Received disconnect from 38.102.83.198 port 44418:11: disconnected by user Feb 20 19:13:23 np0005625471.novalocal sshd-session[80070]: Disconnected from user root 38.102.83.198 port 44418 Feb 20 19:13:23 np0005625471.novalocal sshd-session[80067]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:23 np0005625471.novalocal systemd[1]: session-91.scope: Deactivated successfully. Feb 20 19:13:23 np0005625471.novalocal systemd-logind[833]: Session 91 logged out. Waiting for processes to exit. Feb 20 19:13:23 np0005625471.novalocal systemd-logind[833]: Removed session 91. Feb 20 19:13:24 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:13:24 np0005625471.novalocal systemd-rc-local-generator[80124]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:13:24 np0005625471.novalocal systemd-sysv-generator[80130]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:13:24 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:13:26 np0005625471.novalocal sshd-session[80149]: Accepted publickey for root from 38.102.83.198 port 44434 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:26 np0005625471.novalocal systemd-logind[833]: New session 92 of user root. Feb 20 19:13:26 np0005625471.novalocal systemd[1]: Started Session 92 of User root. Feb 20 19:13:26 np0005625471.novalocal sshd-session[80149]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:26 np0005625471.novalocal sshd-session[80152]: Received disconnect from 38.102.83.198 port 44434:11: disconnected by user Feb 20 19:13:26 np0005625471.novalocal sshd-session[80152]: Disconnected from user root 38.102.83.198 port 44434 Feb 20 19:13:26 np0005625471.novalocal sshd-session[80149]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:26 np0005625471.novalocal systemd[1]: session-92.scope: Deactivated successfully. Feb 20 19:13:26 np0005625471.novalocal systemd-logind[833]: Session 92 logged out. Waiting for processes to exit. Feb 20 19:13:26 np0005625471.novalocal systemd-logind[833]: Removed session 92. Feb 20 19:13:29 np0005625471.novalocal sshd-session[80208]: Accepted publickey for root from 38.102.83.198 port 59684 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:29 np0005625471.novalocal systemd-logind[833]: New session 93 of user root. Feb 20 19:13:29 np0005625471.novalocal systemd[1]: Started Session 93 of User root. Feb 20 19:13:29 np0005625471.novalocal sshd-session[80208]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:30 np0005625471.novalocal sshd-session[80211]: Received disconnect from 38.102.83.198 port 59684:11: disconnected by user Feb 20 19:13:30 np0005625471.novalocal sshd-session[80211]: Disconnected from user root 38.102.83.198 port 59684 Feb 20 19:13:30 np0005625471.novalocal sshd-session[80208]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:30 np0005625471.novalocal systemd-logind[833]: Session 93 logged out. Waiting for processes to exit. Feb 20 19:13:30 np0005625471.novalocal systemd[1]: session-93.scope: Deactivated successfully. Feb 20 19:13:30 np0005625471.novalocal systemd-logind[833]: Removed session 93. Feb 20 19:13:33 np0005625471.novalocal sshd-session[80242]: Accepted publickey for root from 38.102.83.198 port 59700 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:33 np0005625471.novalocal systemd-logind[833]: New session 94 of user root. Feb 20 19:13:33 np0005625471.novalocal systemd[1]: Started Session 94 of User root. Feb 20 19:13:33 np0005625471.novalocal sshd-session[80242]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:33 np0005625471.novalocal sshd-session[80245]: Received disconnect from 38.102.83.198 port 59700:11: disconnected by user Feb 20 19:13:33 np0005625471.novalocal sshd-session[80245]: Disconnected from user root 38.102.83.198 port 59700 Feb 20 19:13:33 np0005625471.novalocal sshd-session[80242]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:33 np0005625471.novalocal systemd-logind[833]: Session 94 logged out. Waiting for processes to exit. Feb 20 19:13:33 np0005625471.novalocal systemd[1]: session-94.scope: Deactivated successfully. Feb 20 19:13:33 np0005625471.novalocal systemd-logind[833]: Removed session 94. Feb 20 19:13:36 np0005625471.novalocal sshd-session[80281]: Accepted publickey for root from 38.102.83.198 port 59704 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:36 np0005625471.novalocal systemd-logind[833]: New session 95 of user root. Feb 20 19:13:36 np0005625471.novalocal systemd[1]: Started Session 95 of User root. Feb 20 19:13:36 np0005625471.novalocal sshd-session[80281]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:36 np0005625471.novalocal sshd-session[80284]: Received disconnect from 38.102.83.198 port 59704:11: disconnected by user Feb 20 19:13:36 np0005625471.novalocal sshd-session[80284]: Disconnected from user root 38.102.83.198 port 59704 Feb 20 19:13:36 np0005625471.novalocal sshd-session[80281]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:36 np0005625471.novalocal systemd[1]: session-95.scope: Deactivated successfully. Feb 20 19:13:36 np0005625471.novalocal systemd-logind[833]: Session 95 logged out. Waiting for processes to exit. Feb 20 19:13:36 np0005625471.novalocal systemd-logind[833]: Removed session 95. Feb 20 19:13:39 np0005625471.novalocal sshd-session[80338]: Accepted publickey for root from 38.102.83.198 port 57620 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:39 np0005625471.novalocal systemd-logind[833]: New session 96 of user root. Feb 20 19:13:39 np0005625471.novalocal systemd[1]: Started Session 96 of User root. Feb 20 19:13:39 np0005625471.novalocal sshd-session[80338]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:39 np0005625471.novalocal sshd-session[80341]: Received disconnect from 38.102.83.198 port 57620:11: disconnected by user Feb 20 19:13:39 np0005625471.novalocal sshd-session[80341]: Disconnected from user root 38.102.83.198 port 57620 Feb 20 19:13:39 np0005625471.novalocal sshd-session[80338]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:39 np0005625471.novalocal systemd-logind[833]: Session 96 logged out. Waiting for processes to exit. Feb 20 19:13:39 np0005625471.novalocal systemd[1]: session-96.scope: Deactivated successfully. Feb 20 19:13:39 np0005625471.novalocal systemd-logind[833]: Removed session 96. Feb 20 19:13:42 np0005625471.novalocal sshd-session[80381]: Accepted publickey for root from 38.102.83.198 port 57634 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:42 np0005625471.novalocal systemd-logind[833]: New session 97 of user root. Feb 20 19:13:42 np0005625471.novalocal systemd[1]: Started Session 97 of User root. Feb 20 19:13:42 np0005625471.novalocal sshd-session[80381]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:43 np0005625471.novalocal sshd-session[80384]: Received disconnect from 38.102.83.198 port 57634:11: disconnected by user Feb 20 19:13:43 np0005625471.novalocal sshd-session[80384]: Disconnected from user root 38.102.83.198 port 57634 Feb 20 19:13:43 np0005625471.novalocal sshd-session[80381]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:43 np0005625471.novalocal systemd[1]: session-97.scope: Deactivated successfully. Feb 20 19:13:43 np0005625471.novalocal systemd-logind[833]: Session 97 logged out. Waiting for processes to exit. Feb 20 19:13:43 np0005625471.novalocal systemd-logind[833]: Removed session 97. Feb 20 19:13:46 np0005625471.novalocal sshd-session[80425]: Accepted publickey for root from 38.102.83.198 port 57648 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:46 np0005625471.novalocal systemd-logind[833]: New session 98 of user root. Feb 20 19:13:46 np0005625471.novalocal systemd[1]: Started Session 98 of User root. Feb 20 19:13:46 np0005625471.novalocal sshd-session[80425]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:46 np0005625471.novalocal sshd-session[80428]: Received disconnect from 38.102.83.198 port 57648:11: disconnected by user Feb 20 19:13:46 np0005625471.novalocal sshd-session[80428]: Disconnected from user root 38.102.83.198 port 57648 Feb 20 19:13:46 np0005625471.novalocal sshd-session[80425]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:46 np0005625471.novalocal systemd[1]: session-98.scope: Deactivated successfully. Feb 20 19:13:46 np0005625471.novalocal systemd-logind[833]: Session 98 logged out. Waiting for processes to exit. Feb 20 19:13:46 np0005625471.novalocal systemd-logind[833]: Removed session 98. Feb 20 19:13:49 np0005625471.novalocal sshd-session[80461]: Accepted publickey for root from 38.102.83.198 port 46294 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:49 np0005625471.novalocal systemd-logind[833]: New session 99 of user root. Feb 20 19:13:49 np0005625471.novalocal systemd[1]: Started Session 99 of User root. Feb 20 19:13:49 np0005625471.novalocal sshd-session[80461]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:49 np0005625471.novalocal sshd-session[80464]: Received disconnect from 38.102.83.198 port 46294:11: disconnected by user Feb 20 19:13:49 np0005625471.novalocal sshd-session[80464]: Disconnected from user root 38.102.83.198 port 46294 Feb 20 19:13:49 np0005625471.novalocal sshd-session[80461]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:49 np0005625471.novalocal systemd[1]: session-99.scope: Deactivated successfully. Feb 20 19:13:49 np0005625471.novalocal systemd-logind[833]: Session 99 logged out. Waiting for processes to exit. Feb 20 19:13:49 np0005625471.novalocal systemd-logind[833]: Removed session 99. Feb 20 19:13:52 np0005625471.novalocal sshd-session[80513]: Accepted publickey for root from 38.102.83.198 port 46300 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:52 np0005625471.novalocal systemd-logind[833]: New session 100 of user root. Feb 20 19:13:52 np0005625471.novalocal systemd[1]: Started Session 100 of User root. Feb 20 19:13:52 np0005625471.novalocal sshd-session[80513]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:52 np0005625471.novalocal sshd-session[80516]: Received disconnect from 38.102.83.198 port 46300:11: disconnected by user Feb 20 19:13:52 np0005625471.novalocal sshd-session[80516]: Disconnected from user root 38.102.83.198 port 46300 Feb 20 19:13:52 np0005625471.novalocal sshd-session[80513]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:52 np0005625471.novalocal systemd[1]: session-100.scope: Deactivated successfully. Feb 20 19:13:52 np0005625471.novalocal systemd-logind[833]: Session 100 logged out. Waiting for processes to exit. Feb 20 19:13:52 np0005625471.novalocal systemd-logind[833]: Removed session 100. Feb 20 19:13:55 np0005625471.novalocal sshd-session[80550]: Accepted publickey for root from 38.102.83.198 port 46312 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:55 np0005625471.novalocal systemd-logind[833]: New session 101 of user root. Feb 20 19:13:55 np0005625471.novalocal systemd[1]: Started Session 101 of User root. Feb 20 19:13:55 np0005625471.novalocal sshd-session[80550]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:56 np0005625471.novalocal sshd-session[80553]: Received disconnect from 38.102.83.198 port 46312:11: disconnected by user Feb 20 19:13:56 np0005625471.novalocal sshd-session[80553]: Disconnected from user root 38.102.83.198 port 46312 Feb 20 19:13:56 np0005625471.novalocal sshd-session[80550]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:56 np0005625471.novalocal systemd[1]: session-101.scope: Deactivated successfully. Feb 20 19:13:56 np0005625471.novalocal systemd-logind[833]: Session 101 logged out. Waiting for processes to exit. Feb 20 19:13:56 np0005625471.novalocal systemd-logind[833]: Removed session 101. Feb 20 19:13:59 np0005625471.novalocal sshd-session[80587]: Accepted publickey for root from 38.102.83.198 port 46314 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:13:59 np0005625471.novalocal systemd-logind[833]: New session 102 of user root. Feb 20 19:13:59 np0005625471.novalocal systemd[1]: Started Session 102 of User root. Feb 20 19:13:59 np0005625471.novalocal sshd-session[80587]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:13:59 np0005625471.novalocal sshd-session[80590]: Received disconnect from 38.102.83.198 port 46314:11: disconnected by user Feb 20 19:13:59 np0005625471.novalocal sshd-session[80590]: Disconnected from user root 38.102.83.198 port 46314 Feb 20 19:13:59 np0005625471.novalocal sshd-session[80587]: pam_unix(sshd:session): session closed for user root Feb 20 19:13:59 np0005625471.novalocal systemd[1]: session-102.scope: Deactivated successfully. Feb 20 19:13:59 np0005625471.novalocal systemd-logind[833]: Session 102 logged out. Waiting for processes to exit. Feb 20 19:13:59 np0005625471.novalocal systemd-logind[833]: Removed session 102. Feb 20 19:14:02 np0005625471.novalocal sshd-session[80621]: Accepted publickey for root from 38.102.83.198 port 38162 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:02 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:14:02 np0005625471.novalocal systemd-logind[833]: New session 103 of user root. Feb 20 19:14:02 np0005625471.novalocal systemd[1]: Started Session 103 of User root. Feb 20 19:14:02 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:14:02 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:14:02 np0005625471.novalocal sshd-session[80621]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:02 np0005625471.novalocal sshd-session[80625]: Received disconnect from 38.102.83.198 port 38162:11: disconnected by user Feb 20 19:14:02 np0005625471.novalocal sshd-session[80625]: Disconnected from user root 38.102.83.198 port 38162 Feb 20 19:14:02 np0005625471.novalocal sshd-session[80621]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:02 np0005625471.novalocal systemd-logind[833]: Session 103 logged out. Waiting for processes to exit. Feb 20 19:14:02 np0005625471.novalocal systemd[1]: session-103.scope: Deactivated successfully. Feb 20 19:14:02 np0005625471.novalocal systemd-logind[833]: Removed session 103. Feb 20 19:14:05 np0005625471.novalocal sshd-session[80657]: Accepted publickey for root from 38.102.83.198 port 38164 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:05 np0005625471.novalocal systemd-logind[833]: New session 104 of user root. Feb 20 19:14:05 np0005625471.novalocal systemd[1]: Started Session 104 of User root. Feb 20 19:14:05 np0005625471.novalocal sshd-session[80657]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:05 np0005625471.novalocal sshd-session[80660]: Received disconnect from 38.102.83.198 port 38164:11: disconnected by user Feb 20 19:14:05 np0005625471.novalocal sshd-session[80660]: Disconnected from user root 38.102.83.198 port 38164 Feb 20 19:14:05 np0005625471.novalocal sshd-session[80657]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:05 np0005625471.novalocal systemd[1]: session-104.scope: Deactivated successfully. Feb 20 19:14:05 np0005625471.novalocal systemd-logind[833]: Session 104 logged out. Waiting for processes to exit. Feb 20 19:14:05 np0005625471.novalocal systemd-logind[833]: Removed session 104. Feb 20 19:14:06 np0005625471.novalocal crontab[80688]: (root) LIST (root) Feb 20 19:14:06 np0005625471.novalocal crontab[80689]: (root) LIST (keystone) Feb 20 19:14:06 np0005625471.novalocal crontab[80690]: (root) LIST (nova) Feb 20 19:14:07 np0005625471.novalocal crontab[80691]: (root) REPLACE (nova) Feb 20 19:14:08 np0005625471.novalocal sshd-session[80698]: Accepted publickey for root from 38.102.83.198 port 38170 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:08 np0005625471.novalocal systemd-logind[833]: New session 105 of user root. Feb 20 19:14:08 np0005625471.novalocal systemd[1]: Started Session 105 of User root. Feb 20 19:14:09 np0005625471.novalocal sshd-session[80698]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:09 np0005625471.novalocal sshd-session[80701]: Received disconnect from 38.102.83.198 port 38170:11: disconnected by user Feb 20 19:14:09 np0005625471.novalocal sshd-session[80701]: Disconnected from user root 38.102.83.198 port 38170 Feb 20 19:14:09 np0005625471.novalocal sshd-session[80698]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:09 np0005625471.novalocal systemd-logind[833]: Session 105 logged out. Waiting for processes to exit. Feb 20 19:14:09 np0005625471.novalocal systemd[1]: session-105.scope: Deactivated successfully. Feb 20 19:14:09 np0005625471.novalocal systemd-logind[833]: Removed session 105. Feb 20 19:14:12 np0005625471.novalocal sshd-session[80744]: Accepted publickey for root from 38.102.83.198 port 55884 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:12 np0005625471.novalocal systemd-logind[833]: New session 106 of user root. Feb 20 19:14:12 np0005625471.novalocal systemd[1]: Started Session 106 of User root. Feb 20 19:14:12 np0005625471.novalocal sshd-session[80744]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:12 np0005625471.novalocal sshd-session[80747]: Received disconnect from 38.102.83.198 port 55884:11: disconnected by user Feb 20 19:14:12 np0005625471.novalocal sshd-session[80747]: Disconnected from user root 38.102.83.198 port 55884 Feb 20 19:14:12 np0005625471.novalocal sshd-session[80744]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:12 np0005625471.novalocal systemd-logind[833]: Session 106 logged out. Waiting for processes to exit. Feb 20 19:14:12 np0005625471.novalocal systemd[1]: session-106.scope: Deactivated successfully. Feb 20 19:14:12 np0005625471.novalocal systemd-logind[833]: Removed session 106. Feb 20 19:14:15 np0005625471.novalocal sshd-session[80788]: Accepted publickey for root from 38.102.83.198 port 55896 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:15 np0005625471.novalocal systemd-logind[833]: New session 107 of user root. Feb 20 19:14:15 np0005625471.novalocal systemd[1]: Started Session 107 of User root. Feb 20 19:14:15 np0005625471.novalocal sshd-session[80788]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:15 np0005625471.novalocal sshd-session[80791]: Received disconnect from 38.102.83.198 port 55896:11: disconnected by user Feb 20 19:14:15 np0005625471.novalocal sshd-session[80791]: Disconnected from user root 38.102.83.198 port 55896 Feb 20 19:14:15 np0005625471.novalocal sshd-session[80788]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:15 np0005625471.novalocal systemd[1]: session-107.scope: Deactivated successfully. Feb 20 19:14:15 np0005625471.novalocal systemd-logind[833]: Session 107 logged out. Waiting for processes to exit. Feb 20 19:14:15 np0005625471.novalocal systemd-logind[833]: Removed session 107. Feb 20 19:14:18 np0005625471.novalocal sshd-session[80822]: Accepted publickey for root from 38.102.83.198 port 55900 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:18 np0005625471.novalocal systemd-logind[833]: New session 108 of user root. Feb 20 19:14:18 np0005625471.novalocal systemd[1]: Started Session 108 of User root. Feb 20 19:14:18 np0005625471.novalocal sshd-session[80822]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:18 np0005625471.novalocal sshd-session[80825]: Received disconnect from 38.102.83.198 port 55900:11: disconnected by user Feb 20 19:14:18 np0005625471.novalocal sshd-session[80825]: Disconnected from user root 38.102.83.198 port 55900 Feb 20 19:14:18 np0005625471.novalocal sshd-session[80822]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:18 np0005625471.novalocal systemd[1]: session-108.scope: Deactivated successfully. Feb 20 19:14:18 np0005625471.novalocal systemd-logind[833]: Session 108 logged out. Waiting for processes to exit. Feb 20 19:14:18 np0005625471.novalocal systemd-logind[833]: Removed session 108. Feb 20 19:14:22 np0005625471.novalocal sshd-session[80856]: Accepted publickey for root from 38.102.83.198 port 47348 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:22 np0005625471.novalocal systemd-logind[833]: New session 109 of user root. Feb 20 19:14:22 np0005625471.novalocal systemd[1]: Started Session 109 of User root. Feb 20 19:14:22 np0005625471.novalocal sshd-session[80856]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:22 np0005625471.novalocal sshd-session[80859]: Received disconnect from 38.102.83.198 port 47348:11: disconnected by user Feb 20 19:14:22 np0005625471.novalocal sshd-session[80859]: Disconnected from user root 38.102.83.198 port 47348 Feb 20 19:14:22 np0005625471.novalocal sshd-session[80856]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:22 np0005625471.novalocal systemd[1]: session-109.scope: Deactivated successfully. Feb 20 19:14:22 np0005625471.novalocal systemd-logind[833]: Session 109 logged out. Waiting for processes to exit. Feb 20 19:14:22 np0005625471.novalocal systemd-logind[833]: Removed session 109. Feb 20 19:14:25 np0005625471.novalocal sshd-session[80891]: Accepted publickey for root from 38.102.83.198 port 47356 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:25 np0005625471.novalocal systemd-logind[833]: New session 110 of user root. Feb 20 19:14:25 np0005625471.novalocal systemd[1]: Started Session 110 of User root. Feb 20 19:14:25 np0005625471.novalocal sshd-session[80891]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:25 np0005625471.novalocal sshd-session[80894]: Received disconnect from 38.102.83.198 port 47356:11: disconnected by user Feb 20 19:14:25 np0005625471.novalocal sshd-session[80894]: Disconnected from user root 38.102.83.198 port 47356 Feb 20 19:14:25 np0005625471.novalocal sshd-session[80891]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:25 np0005625471.novalocal systemd[1]: session-110.scope: Deactivated successfully. Feb 20 19:14:25 np0005625471.novalocal systemd-logind[833]: Session 110 logged out. Waiting for processes to exit. Feb 20 19:14:25 np0005625471.novalocal systemd-logind[833]: Removed session 110. Feb 20 19:14:28 np0005625471.novalocal sshd-session[80931]: Accepted publickey for root from 38.102.83.198 port 47372 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:28 np0005625471.novalocal systemd-logind[833]: New session 111 of user root. Feb 20 19:14:28 np0005625471.novalocal systemd[1]: Started Session 111 of User root. Feb 20 19:14:28 np0005625471.novalocal sshd-session[80931]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:28 np0005625471.novalocal sshd-session[80934]: Received disconnect from 38.102.83.198 port 47372:11: disconnected by user Feb 20 19:14:28 np0005625471.novalocal sshd-session[80934]: Disconnected from user root 38.102.83.198 port 47372 Feb 20 19:14:28 np0005625471.novalocal sshd-session[80931]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:28 np0005625471.novalocal systemd[1]: session-111.scope: Deactivated successfully. Feb 20 19:14:28 np0005625471.novalocal systemd-logind[833]: Session 111 logged out. Waiting for processes to exit. Feb 20 19:14:28 np0005625471.novalocal systemd-logind[833]: Removed session 111. Feb 20 19:14:28 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:14:28 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:14:28 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:14:29 np0005625471.novalocal systemd-rc-local-generator[80996]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:14:29 np0005625471.novalocal systemd-sysv-generator[81000]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:14:29 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:14:29 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:14:29 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:14:29 np0005625471.novalocal systemd[1]: run-rb128e672e40d48238978494cedcb9303.service: Deactivated successfully. Feb 20 19:14:31 np0005625471.novalocal sshd-session[81209]: Accepted publickey for root from 38.102.83.198 port 42210 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:31 np0005625471.novalocal systemd-logind[833]: New session 112 of user root. Feb 20 19:14:31 np0005625471.novalocal systemd[1]: Started Session 112 of User root. Feb 20 19:14:31 np0005625471.novalocal sshd-session[81209]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:31 np0005625471.novalocal sshd-session[81224]: Received disconnect from 38.102.83.198 port 42210:11: disconnected by user Feb 20 19:14:31 np0005625471.novalocal sshd-session[81224]: Disconnected from user root 38.102.83.198 port 42210 Feb 20 19:14:31 np0005625471.novalocal sshd-session[81209]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:31 np0005625471.novalocal systemd[1]: session-112.scope: Deactivated successfully. Feb 20 19:14:31 np0005625471.novalocal systemd-logind[833]: Session 112 logged out. Waiting for processes to exit. Feb 20 19:14:31 np0005625471.novalocal systemd-logind[833]: Removed session 112. Feb 20 19:14:32 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:14:32 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:14:32 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:14:32 np0005625471.novalocal systemd-sysv-generator[81280]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:14:32 np0005625471.novalocal systemd-rc-local-generator[81276]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:14:32 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:14:33 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:14:33 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:14:33 np0005625471.novalocal systemd[1]: run-r4773e8b97c214932a58eab3eb2bf3181.service: Deactivated successfully. Feb 20 19:14:35 np0005625471.novalocal sshd-session[81495]: Accepted publickey for root from 38.102.83.198 port 42222 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:35 np0005625471.novalocal systemd-logind[833]: New session 113 of user root. Feb 20 19:14:35 np0005625471.novalocal systemd[1]: Started Session 113 of User root. Feb 20 19:14:35 np0005625471.novalocal sshd-session[81495]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:35 np0005625471.novalocal sshd-session[81506]: Received disconnect from 38.102.83.198 port 42222:11: disconnected by user Feb 20 19:14:35 np0005625471.novalocal sshd-session[81506]: Disconnected from user root 38.102.83.198 port 42222 Feb 20 19:14:35 np0005625471.novalocal sshd-session[81495]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:35 np0005625471.novalocal systemd-logind[833]: Session 113 logged out. Waiting for processes to exit. Feb 20 19:14:35 np0005625471.novalocal systemd[1]: session-113.scope: Deactivated successfully. Feb 20 19:14:35 np0005625471.novalocal systemd-logind[833]: Removed session 113. Feb 20 19:14:35 np0005625471.novalocal systemd[1]: Started /usr/bin/systemctl start man-db-cache-update. Feb 20 19:14:35 np0005625471.novalocal systemd[1]: Starting man-db-cache-update.service... Feb 20 19:14:35 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:14:35 np0005625471.novalocal systemd-sysv-generator[81564]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:14:35 np0005625471.novalocal systemd-rc-local-generator[81561]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:14:35 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:14:35 np0005625471.novalocal systemd[1]: man-db-cache-update.service: Deactivated successfully. Feb 20 19:14:35 np0005625471.novalocal systemd[1]: Finished man-db-cache-update.service. Feb 20 19:14:35 np0005625471.novalocal systemd[1]: run-rfad05dbbc78d497998a00b8ec9293eef.service: Deactivated successfully. Feb 20 19:14:38 np0005625471.novalocal sshd-session[81775]: Accepted publickey for root from 38.102.83.198 port 42234 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:38 np0005625471.novalocal systemd-logind[833]: New session 114 of user root. Feb 20 19:14:38 np0005625471.novalocal systemd[1]: Started Session 114 of User root. Feb 20 19:14:38 np0005625471.novalocal sshd-session[81775]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:38 np0005625471.novalocal sshd-session[81779]: Received disconnect from 38.102.83.198 port 42234:11: disconnected by user Feb 20 19:14:38 np0005625471.novalocal sshd-session[81779]: Disconnected from user root 38.102.83.198 port 42234 Feb 20 19:14:38 np0005625471.novalocal sshd-session[81775]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:38 np0005625471.novalocal systemd[1]: session-114.scope: Deactivated successfully. Feb 20 19:14:38 np0005625471.novalocal systemd-logind[833]: Session 114 logged out. Waiting for processes to exit. Feb 20 19:14:38 np0005625471.novalocal systemd-logind[833]: Removed session 114. Feb 20 19:14:41 np0005625471.novalocal sshd-session[81823]: Accepted publickey for root from 38.102.83.198 port 50848 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:41 np0005625471.novalocal systemd-logind[833]: New session 115 of user root. Feb 20 19:14:41 np0005625471.novalocal systemd[1]: Started Session 115 of User root. Feb 20 19:14:41 np0005625471.novalocal sshd-session[81823]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:41 np0005625471.novalocal sshd-session[81826]: Received disconnect from 38.102.83.198 port 50848:11: disconnected by user Feb 20 19:14:41 np0005625471.novalocal sshd-session[81826]: Disconnected from user root 38.102.83.198 port 50848 Feb 20 19:14:41 np0005625471.novalocal sshd-session[81823]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:41 np0005625471.novalocal systemd[1]: session-115.scope: Deactivated successfully. Feb 20 19:14:41 np0005625471.novalocal systemd-logind[833]: Session 115 logged out. Waiting for processes to exit. Feb 20 19:14:41 np0005625471.novalocal systemd-logind[833]: Removed session 115. Feb 20 19:14:44 np0005625471.novalocal sshd-session[81857]: Accepted publickey for root from 38.102.83.198 port 50850 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:44 np0005625471.novalocal systemd-logind[833]: New session 116 of user root. Feb 20 19:14:44 np0005625471.novalocal systemd[1]: Started Session 116 of User root. Feb 20 19:14:44 np0005625471.novalocal sshd-session[81857]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:44 np0005625471.novalocal sshd-session[81860]: Received disconnect from 38.102.83.198 port 50850:11: disconnected by user Feb 20 19:14:44 np0005625471.novalocal sshd-session[81860]: Disconnected from user root 38.102.83.198 port 50850 Feb 20 19:14:44 np0005625471.novalocal sshd-session[81857]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:44 np0005625471.novalocal systemd[1]: session-116.scope: Deactivated successfully. Feb 20 19:14:44 np0005625471.novalocal systemd-logind[833]: Session 116 logged out. Waiting for processes to exit. Feb 20 19:14:44 np0005625471.novalocal systemd-logind[833]: Removed session 116. Feb 20 19:14:46 np0005625471.novalocal systemd[60093]: Created slice User Background Tasks Slice. Feb 20 19:14:46 np0005625471.novalocal systemd[60093]: Starting Cleanup of User's Temporary Files and Directories... Feb 20 19:14:46 np0005625471.novalocal systemd[60093]: Finished Cleanup of User's Temporary Files and Directories. Feb 20 19:14:48 np0005625471.novalocal sshd-session[81894]: Accepted publickey for root from 38.102.83.198 port 50862 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:48 np0005625471.novalocal systemd-logind[833]: New session 117 of user root. Feb 20 19:14:48 np0005625471.novalocal systemd[1]: Started Session 117 of User root. Feb 20 19:14:48 np0005625471.novalocal sshd-session[81894]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:48 np0005625471.novalocal sshd-session[81897]: Received disconnect from 38.102.83.198 port 50862:11: disconnected by user Feb 20 19:14:48 np0005625471.novalocal sshd-session[81897]: Disconnected from user root 38.102.83.198 port 50862 Feb 20 19:14:48 np0005625471.novalocal sshd-session[81894]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:48 np0005625471.novalocal systemd-logind[833]: Session 117 logged out. Waiting for processes to exit. Feb 20 19:14:48 np0005625471.novalocal systemd[1]: session-117.scope: Deactivated successfully. Feb 20 19:14:48 np0005625471.novalocal systemd-logind[833]: Removed session 117. Feb 20 19:14:51 np0005625471.novalocal sshd-session[81928]: Accepted publickey for root from 38.102.83.198 port 57552 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:51 np0005625471.novalocal systemd-logind[833]: New session 118 of user root. Feb 20 19:14:51 np0005625471.novalocal systemd[1]: Started Session 118 of User root. Feb 20 19:14:51 np0005625471.novalocal sshd-session[81928]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:51 np0005625471.novalocal sshd-session[81931]: Received disconnect from 38.102.83.198 port 57552:11: disconnected by user Feb 20 19:14:51 np0005625471.novalocal sshd-session[81931]: Disconnected from user root 38.102.83.198 port 57552 Feb 20 19:14:51 np0005625471.novalocal sshd-session[81928]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:51 np0005625471.novalocal systemd-logind[833]: Session 118 logged out. Waiting for processes to exit. Feb 20 19:14:51 np0005625471.novalocal systemd[1]: session-118.scope: Deactivated successfully. Feb 20 19:14:51 np0005625471.novalocal systemd-logind[833]: Removed session 118. Feb 20 19:14:54 np0005625471.novalocal sshd-session[81964]: Accepted publickey for root from 38.102.83.198 port 57556 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:54 np0005625471.novalocal systemd-logind[833]: New session 119 of user root. Feb 20 19:14:54 np0005625471.novalocal systemd[1]: Started Session 119 of User root. Feb 20 19:14:54 np0005625471.novalocal sshd-session[81964]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:54 np0005625471.novalocal sshd-session[81967]: Received disconnect from 38.102.83.198 port 57556:11: disconnected by user Feb 20 19:14:54 np0005625471.novalocal sshd-session[81967]: Disconnected from user root 38.102.83.198 port 57556 Feb 20 19:14:54 np0005625471.novalocal sshd-session[81964]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:54 np0005625471.novalocal systemd[1]: session-119.scope: Deactivated successfully. Feb 20 19:14:54 np0005625471.novalocal systemd-logind[833]: Session 119 logged out. Waiting for processes to exit. Feb 20 19:14:54 np0005625471.novalocal systemd-logind[833]: Removed session 119. Feb 20 19:14:57 np0005625471.novalocal rsyncd[82002]: 38.102.83.198 is not a known address for "np0005625471.novalocal": spoofed address? Feb 20 19:14:57 np0005625471.novalocal rsyncd[82002]: connect from UNKNOWN (38.102.83.198) Feb 20 19:14:57 np0005625471.novalocal rsyncd[82002]: rsync allowed access on module swift_server from UNKNOWN (38.102.83.198) Feb 20 19:14:57 np0005625471.novalocal rsyncd[82002]: rsync on swift_server/account.ring.gz from UNKNOWN (38.102.83.198) Feb 20 19:14:57 np0005625471.novalocal rsyncd[82002]: building file list Feb 20 19:14:57 np0005625471.novalocal rsyncd[82002]: sent 85 bytes received 25 bytes total size 746 Feb 20 19:14:57 np0005625471.novalocal rsyncd[82008]: 38.102.83.198 is not a known address for "np0005625471.novalocal": spoofed address? Feb 20 19:14:57 np0005625471.novalocal rsyncd[82008]: connect from UNKNOWN (38.102.83.198) Feb 20 19:14:57 np0005625471.novalocal rsyncd[82008]: rsync allowed access on module swift_server from UNKNOWN (38.102.83.198) Feb 20 19:14:57 np0005625471.novalocal rsyncd[82008]: rsync on swift_server/container.ring.gz from UNKNOWN (38.102.83.198) Feb 20 19:14:57 np0005625471.novalocal rsyncd[82008]: building file list Feb 20 19:14:57 np0005625471.novalocal rsyncd[82008]: sent 87 bytes received 25 bytes total size 747 Feb 20 19:14:57 np0005625471.novalocal rsyncd[82014]: 38.102.83.198 is not a known address for "np0005625471.novalocal": spoofed address? Feb 20 19:14:57 np0005625471.novalocal rsyncd[82014]: connect from UNKNOWN (38.102.83.198) Feb 20 19:14:57 np0005625471.novalocal rsyncd[82014]: rsync allowed access on module swift_server from UNKNOWN (38.102.83.198) Feb 20 19:14:57 np0005625471.novalocal rsyncd[82014]: rsync on swift_server/object.ring.gz from UNKNOWN (38.102.83.198) Feb 20 19:14:57 np0005625471.novalocal rsyncd[82014]: building file list Feb 20 19:14:57 np0005625471.novalocal rsyncd[82014]: sent 84 bytes received 25 bytes total size 744 Feb 20 19:14:57 np0005625471.novalocal sshd-session[82019]: Accepted publickey for root from 38.102.83.198 port 57564 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:14:57 np0005625471.novalocal systemd-logind[833]: New session 120 of user root. Feb 20 19:14:57 np0005625471.novalocal systemd[1]: Started Session 120 of User root. Feb 20 19:14:57 np0005625471.novalocal sshd-session[82019]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:14:57 np0005625471.novalocal sshd-session[82022]: Received disconnect from 38.102.83.198 port 57564:11: disconnected by user Feb 20 19:14:57 np0005625471.novalocal sshd-session[82022]: Disconnected from user root 38.102.83.198 port 57564 Feb 20 19:14:57 np0005625471.novalocal sshd-session[82019]: pam_unix(sshd:session): session closed for user root Feb 20 19:14:57 np0005625471.novalocal systemd[1]: session-120.scope: Deactivated successfully. Feb 20 19:14:57 np0005625471.novalocal systemd-logind[833]: Session 120 logged out. Waiting for processes to exit. Feb 20 19:14:57 np0005625471.novalocal systemd-logind[833]: Removed session 120. Feb 20 19:15:01 np0005625471.novalocal sshd-session[82063]: Accepted publickey for root from 38.102.83.198 port 33736 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:01 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:15:01 np0005625471.novalocal systemd-logind[833]: New session 121 of user root. Feb 20 19:15:01 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:15:01 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:15:01 np0005625471.novalocal systemd[1]: Started Session 121 of User root. Feb 20 19:15:01 np0005625471.novalocal sshd-session[82063]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:01 np0005625471.novalocal sshd-session[82067]: Received disconnect from 38.102.83.198 port 33736:11: disconnected by user Feb 20 19:15:01 np0005625471.novalocal sshd-session[82067]: Disconnected from user root 38.102.83.198 port 33736 Feb 20 19:15:01 np0005625471.novalocal sshd-session[82063]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:01 np0005625471.novalocal systemd[1]: session-121.scope: Deactivated successfully. Feb 20 19:15:01 np0005625471.novalocal systemd-logind[833]: Session 121 logged out. Waiting for processes to exit. Feb 20 19:15:01 np0005625471.novalocal systemd-logind[833]: Removed session 121. Feb 20 19:15:04 np0005625471.novalocal kernel: loop: module loaded Feb 20 19:15:04 np0005625471.novalocal kernel: loop0: detected capacity change from 0 to 4194304 Feb 20 19:15:04 np0005625471.novalocal sshd-session[82106]: Accepted publickey for root from 38.102.83.198 port 33746 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:04 np0005625471.novalocal systemd-logind[833]: New session 122 of user root. Feb 20 19:15:04 np0005625471.novalocal systemd[1]: Started Session 122 of User root. Feb 20 19:15:04 np0005625471.novalocal sshd-session[82106]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:04 np0005625471.novalocal sshd-session[82116]: Received disconnect from 38.102.83.198 port 33746:11: disconnected by user Feb 20 19:15:04 np0005625471.novalocal sshd-session[82116]: Disconnected from user root 38.102.83.198 port 33746 Feb 20 19:15:04 np0005625471.novalocal sshd-session[82106]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:04 np0005625471.novalocal systemd[1]: session-122.scope: Deactivated successfully. Feb 20 19:15:04 np0005625471.novalocal systemd-logind[833]: Session 122 logged out. Waiting for processes to exit. Feb 20 19:15:04 np0005625471.novalocal systemd-logind[833]: Removed session 122. Feb 20 19:15:04 np0005625471.novalocal kernel: EXT4-fs (loop0): mounted filesystem ffadbcf4-b584-43b7-933c-d836c52fd83d r/w with ordered data mode. Quota mode: none. Feb 20 19:15:04 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:05 np0005625471.novalocal systemd-rc-local-generator[82169]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:05 np0005625471.novalocal systemd-sysv-generator[82176]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:05 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Proxy Server. Feb 20 19:15:05 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:05 np0005625471.novalocal systemd-rc-local-generator[82214]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:05 np0005625471.novalocal systemd-sysv-generator[82217]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:05 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:05 np0005625471.novalocal systemd-rc-local-generator[82247]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:05 np0005625471.novalocal systemd-sysv-generator[82250]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:06 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:06 np0005625471.novalocal proxy-server[82190]: Adding required filter versioned_writes to pipeline at position 19 Feb 20 19:15:06 np0005625471.novalocal proxy-server[82190]: Pipeline was modified. New pipeline is "catch_errors gatekeeper healthcheck proxy-logging cache listing_formats bulk tempurl ratelimit crossdomain authtoken keystone formpost staticweb copy container_quotas account_quotas slo dlo versioned_writes proxy-logging proxy-server". Feb 20 19:15:06 np0005625471.novalocal proxy-server[82190]: The following digest algorithms are allowed by default but deprecated: sha1. Support will be disabled by default in a future release, and later removed entirely. Feb 20 19:15:06 np0005625471.novalocal proxy-server[82190]: The following digest algorithms are allowed by default but deprecated: sha1. Support will be disabled by default in a future release, and later removed entirely. Feb 20 19:15:06 np0005625471.novalocal systemd-rc-local-generator[82292]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:06 np0005625471.novalocal proxy-server[82190]: Starting Keystone auth_token middleware Feb 20 19:15:06 np0005625471.novalocal systemd-sysv-generator[82295]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "bind_port" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "workers" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "user" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "bind_ip" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "log_name" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "log_facility" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "log_level" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "log_headers" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "log_address" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "project_name" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "username" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "password" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "auth_url" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "user_domain_id" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "project_domain_id" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal swift-proxy-server[82190]: The option "__name__" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82190]: AuthToken middleware is set with keystone_authtoken.service_token_roles_required set to False. This is backwards compatible but deprecated behaviour. Please set this to True. Feb 20 19:15:06 np0005625471.novalocal proxy-server[82190]: Started child 82306 from parent 82190 Feb 20 19:15:06 np0005625471.novalocal proxy-server[82190]: Started child 82307 from parent 82190 Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: Adding required filter versioned_writes to pipeline at position 19 Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: Pipeline was modified. New pipeline is "catch_errors gatekeeper healthcheck proxy-logging cache listing_formats bulk tempurl ratelimit crossdomain authtoken keystone formpost staticweb copy container_quotas account_quotas slo dlo versioned_writes proxy-logging proxy-server". Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: The following digest algorithms are allowed by default but deprecated: sha1. Support will be disabled by default in a future release, and later removed entirely. Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: The following digest algorithms are allowed by default but deprecated: sha1. Support will be disabled by default in a future release, and later removed entirely. Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: Adding required filter versioned_writes to pipeline at position 19 Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: Pipeline was modified. New pipeline is "catch_errors gatekeeper healthcheck proxy-logging cache listing_formats bulk tempurl ratelimit crossdomain authtoken keystone formpost staticweb copy container_quotas account_quotas slo dlo versioned_writes proxy-logging proxy-server". Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: The following digest algorithms are allowed by default but deprecated: sha1. Support will be disabled by default in a future release, and later removed entirely. Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: The following digest algorithms are allowed by default but deprecated: sha1. Support will be disabled by default in a future release, and later removed entirely. Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: Starting Keystone auth_token middleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "bind_port" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "workers" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "user" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "bind_ip" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "log_name" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "log_facility" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "log_level" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "log_headers" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "log_address" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "project_name" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "username" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "password" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "auth_url" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "user_domain_id" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "project_domain_id" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: STDERR: The option "__name__" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82306]: AuthToken middleware is set with keystone_authtoken.service_token_roles_required set to False. This is backwards compatible but deprecated behaviour. Please set this to True. Feb 20 19:15:06 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Object Expirer. Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: Starting Keystone auth_token middleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "bind_port" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "workers" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "user" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "bind_ip" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "log_name" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "log_facility" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "log_level" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "log_headers" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "log_address" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "project_name" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "username" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "password" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "auth_url" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "user_domain_id" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "project_domain_id" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: STDERR: The option "__name__" is not known to keystonemiddleware Feb 20 19:15:06 np0005625471.novalocal proxy-server[82307]: AuthToken middleware is set with keystone_authtoken.service_token_roles_required set to False. This is backwards compatible but deprecated behaviour. Please set this to True. Feb 20 19:15:06 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:06 np0005625471.novalocal systemd-sysv-generator[82333]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:06 np0005625471.novalocal systemd-rc-local-generator[82329]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:06 np0005625471.novalocal object-expirer[82309]: Starting 82309 Feb 20 19:15:06 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:06 np0005625471.novalocal systemd-rc-local-generator[82366]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:06 np0005625471.novalocal systemd-sysv-generator[82370]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:07 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:07 np0005625471.novalocal systemd-sysv-generator[82412]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:07 np0005625471.novalocal systemd-rc-local-generator[82407]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:07 np0005625471.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Feb 20 19:15:07 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Account Reaper. Feb 20 19:15:07 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:07 np0005625471.novalocal sshd-session[82432]: Accepted publickey for root from 38.102.83.198 port 33756 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:07 np0005625471.novalocal systemd-rc-local-generator[82455]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:07 np0005625471.novalocal systemd-sysv-generator[82459]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:07 np0005625471.novalocal systemd-logind[833]: New session 123 of user root. Feb 20 19:15:07 np0005625471.novalocal systemd[1]: Started Session 123 of User root. Feb 20 19:15:07 np0005625471.novalocal sshd-session[82432]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:07 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:07 np0005625471.novalocal systemd-rc-local-generator[82496]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:07 np0005625471.novalocal systemd-sysv-generator[82500]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:07 np0005625471.novalocal sshd-session[82474]: Received disconnect from 38.102.83.198 port 33756:11: disconnected by user Feb 20 19:15:07 np0005625471.novalocal sshd-session[82474]: Disconnected from user root 38.102.83.198 port 33756 Feb 20 19:15:07 np0005625471.novalocal account-server[82427]: Starting 82427 Feb 20 19:15:08 np0005625471.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Feb 20 19:15:08 np0005625471.novalocal sshd-session[82432]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:08 np0005625471.novalocal systemd[1]: session-123.scope: Deactivated successfully. Feb 20 19:15:08 np0005625471.novalocal systemd-logind[833]: Session 123 logged out. Waiting for processes to exit. Feb 20 19:15:08 np0005625471.novalocal systemd-logind[833]: Removed session 123. Feb 20 19:15:08 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:08 np0005625471.novalocal systemd-sysv-generator[82575]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:08 np0005625471.novalocal systemd-rc-local-generator[82569]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:08 np0005625471.novalocal systemd[1]: Created slice Slice /system/dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged. Feb 20 19:15:08 np0005625471.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@0.service. Feb 20 19:15:08 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Container Updater. Feb 20 19:15:08 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:08 np0005625471.novalocal systemd-rc-local-generator[82609]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:08 np0005625471.novalocal systemd-sysv-generator[82612]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:08 np0005625471.novalocal container-server[82588]: Starting 82588 Feb 20 19:15:08 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:09 np0005625471.novalocal systemd-sysv-generator[82654]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:09 np0005625471.novalocal systemd-rc-local-generator[82650]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:09 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:09 np0005625471.novalocal systemd-rc-local-generator[82688]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:09 np0005625471.novalocal systemd-sysv-generator[82692]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/sudo. For complete SELinux messages run: sealert -l 10310aa7-5045-498d-90c9-d76e67851c38 Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/sudo. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the sudo file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:09 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Container Sync. Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. For complete SELinux messages run: sealert -l 87f4295e-6268-437a-90bd-31240d563fdb Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the hostname file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. For complete SELinux messages run: sealert -l a4af6806-48ae-4ef8-a4b0-2d95e2c96275 Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the gpg file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 2d040e69-1371-406b-adbf-8263d3f70d69 Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:09 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. For complete SELinux messages run: sealert -l 87632ef8-1d50-4ac0-a8b2-0d018a3eee47 Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the dnf-utils file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. For complete SELinux messages run: sealert -l a0b0e4bc-38d3-4e7d-bbd8-800449a9109a Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the traceroute file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. For complete SELinux messages run: sealert -l b01f799d-3db9-4fdc-a565-e36c32a597e0 Feb 20 19:15:09 np0005625471.novalocal systemd-rc-local-generator[82737]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the consolehelper file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:09 np0005625471.novalocal systemd-sysv-generator[82742]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. For complete SELinux messages run: sealert -l 21473398-d232-4111-9d85-cfb1277aa8c8 Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadb-backup file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. For complete SELinux messages run: sealert -l 4a32cb72-2c46-4354-86ed-562259a9b3b9 Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadbd-safe file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. For complete SELinux messages run: sealert -l c488dbcf-4d5b-44f8-9c24-ce95c183bf4f Feb 20 19:15:09 np0005625471.novalocal setroubleshoot[82425]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the keepalived file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'swift-proxy-ser' --raw | audit2allow -M my-swiftproxyser # semodule -X 300 -i my-swiftproxyser.pp Feb 20 19:15:10 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:10 np0005625471.novalocal systemd-rc-local-generator[82781]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:10 np0005625471.novalocal systemd-sysv-generator[82787]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:10 np0005625471.novalocal container-server[82708]: Starting 82708 Feb 20 19:15:10 np0005625471.novalocal container-server[82708]: Configuration option internal_client_conf_path not defined. Using default configuration, See internal-client.conf-sample for options Feb 20 19:15:10 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:10 np0005625471.novalocal systemd-rc-local-generator[82817]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:10 np0005625471.novalocal systemd-sysv-generator[82824]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:10 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Container Sharder. Feb 20 19:15:10 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:10 np0005625471.novalocal systemd-rc-local-generator[82859]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:10 np0005625471.novalocal systemd-sysv-generator[82862]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:11 np0005625471.novalocal sshd-session[82876]: Accepted publickey for root from 38.102.83.198 port 58314 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:11 np0005625471.novalocal systemd-logind[833]: New session 124 of user root. Feb 20 19:15:11 np0005625471.novalocal systemd[1]: Started Session 124 of User root. Feb 20 19:15:11 np0005625471.novalocal sshd-session[82876]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:11 np0005625471.novalocal container-server[82834]: Starting 82834 Feb 20 19:15:11 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:11 np0005625471.novalocal systemd-sysv-generator[82923]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:11 np0005625471.novalocal systemd-rc-local-generator[82920]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:11 np0005625471.novalocal sshd-session[82880]: Received disconnect from 38.102.83.198 port 58314:11: disconnected by user Feb 20 19:15:11 np0005625471.novalocal sshd-session[82880]: Disconnected from user root 38.102.83.198 port 58314 Feb 20 19:15:11 np0005625471.novalocal sshd-session[82876]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:11 np0005625471.novalocal systemd[1]: session-124.scope: Deactivated successfully. Feb 20 19:15:11 np0005625471.novalocal systemd-logind[833]: Session 124 logged out. Waiting for processes to exit. Feb 20 19:15:11 np0005625471.novalocal systemd-logind[833]: Removed session 124. Feb 20 19:15:11 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:11 np0005625471.novalocal systemd-rc-local-generator[82968]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:11 np0005625471.novalocal systemd-sysv-generator[82971]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:11 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Object Updater. Feb 20 19:15:12 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:12 np0005625471.novalocal systemd-rc-local-generator[83005]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:12 np0005625471.novalocal systemd-sysv-generator[83008]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:12 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:12 np0005625471.novalocal systemd-rc-local-generator[83046]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:12 np0005625471.novalocal systemd-sysv-generator[83051]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:12 np0005625471.novalocal object-server[82985]: Starting 82985 Feb 20 19:15:12 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:12 np0005625471.novalocal systemd-rc-local-generator[83089]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:12 np0005625471.novalocal systemd-sysv-generator[83092]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:13 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Object Reconstructor. Feb 20 19:15:13 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:13 np0005625471.novalocal systemd-rc-local-generator[83123]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:13 np0005625471.novalocal systemd-sysv-generator[83127]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:13 np0005625471.novalocal object-server[83104]: Starting 83104 Feb 20 19:15:13 np0005625471.novalocal object-server[83104]: Starting object reconstructor in daemon mode. Feb 20 19:15:13 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:15:13 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.0001761913299560547 seconds. Feb 20 19:15:13 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:15:13 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:13 np0005625471.novalocal systemd-rc-local-generator[83165]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:13 np0005625471.novalocal systemd-sysv-generator[83168]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:13 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:13 np0005625471.novalocal systemd-sysv-generator[83211]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:13 np0005625471.novalocal systemd-rc-local-generator[83206]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:14 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Account Server. Feb 20 19:15:14 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:14 np0005625471.novalocal systemd-rc-local-generator[83247]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:14 np0005625471.novalocal systemd-sysv-generator[83250]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:14 np0005625471.novalocal sshd-session[83254]: Accepted publickey for root from 38.102.83.198 port 58324 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:14 np0005625471.novalocal systemd-logind[833]: New session 125 of user root. Feb 20 19:15:14 np0005625471.novalocal account-server[83223]: Started child 83271 from parent 83223 Feb 20 19:15:14 np0005625471.novalocal account-server[83223]: Started child 83272 from parent 83223 Feb 20 19:15:14 np0005625471.novalocal account-server[83223]: Started child 83273 from parent 83223 Feb 20 19:15:14 np0005625471.novalocal account-server[83223]: Started child 83274 from parent 83223 Feb 20 19:15:14 np0005625471.novalocal systemd[1]: Started Session 125 of User root. Feb 20 19:15:14 np0005625471.novalocal sshd-session[83254]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:14 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:14 np0005625471.novalocal systemd-rc-local-generator[83314]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:14 np0005625471.novalocal systemd-sysv-generator[83320]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:14 np0005625471.novalocal sshd-session[83275]: Received disconnect from 38.102.83.198 port 58324:11: disconnected by user Feb 20 19:15:14 np0005625471.novalocal sshd-session[83275]: Disconnected from user root 38.102.83.198 port 58324 Feb 20 19:15:14 np0005625471.novalocal sshd-session[83254]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:14 np0005625471.novalocal systemd[1]: session-125.scope: Deactivated successfully. Feb 20 19:15:14 np0005625471.novalocal systemd-logind[833]: Session 125 logged out. Waiting for processes to exit. Feb 20 19:15:14 np0005625471.novalocal systemd-logind[833]: Removed session 125. Feb 20 19:15:14 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:15 np0005625471.novalocal systemd-rc-local-generator[83358]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:15 np0005625471.novalocal systemd-sysv-generator[83361]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:15 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Account Replicator. Feb 20 19:15:15 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:15 np0005625471.novalocal systemd-rc-local-generator[83397]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:15 np0005625471.novalocal systemd-sysv-generator[83401]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:15 np0005625471.novalocal account-server[83378]: Starting 83378 Feb 20 19:15:15 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:15 np0005625471.novalocal systemd-rc-local-generator[83436]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:15 np0005625471.novalocal systemd-sysv-generator[83442]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:16 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:16 np0005625471.novalocal systemd-rc-local-generator[83477]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:16 np0005625471.novalocal systemd-sysv-generator[83480]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:16 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Account Auditor. Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Found no containers directories Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:16 2026 visited - attempted:0 success:0 failure:0 skipped:0 completed:0 Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:16 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:16 2026 created - attempted:0 success:0 failure:0 Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:16 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:16 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:16 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:16 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:15:16 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.00s Feb 20 19:15:16 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:16 np0005625471.novalocal systemd-sysv-generator[83519]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:16 np0005625471.novalocal systemd-rc-local-generator[83516]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:16 np0005625471.novalocal account-server[83496]: Starting 83496 Feb 20 19:15:16 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:16 np0005625471.novalocal systemd-rc-local-generator[83559]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:16 np0005625471.novalocal systemd-sysv-generator[83562]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:17 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:17 np0005625471.novalocal systemd-rc-local-generator[83593]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:17 np0005625471.novalocal systemd-sysv-generator[83597]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:17 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Container Server. Feb 20 19:15:17 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:17 np0005625471.novalocal sshd-session[83618]: Accepted publickey for root from 38.102.83.198 port 58328 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:17 np0005625471.novalocal systemd-rc-local-generator[83638]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:17 np0005625471.novalocal systemd-sysv-generator[83643]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:17 np0005625471.novalocal systemd-logind[833]: New session 126 of user root. Feb 20 19:15:17 np0005625471.novalocal systemd[1]: Started Session 126 of User root. Feb 20 19:15:17 np0005625471.novalocal sshd-session[83618]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:17 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:17 np0005625471.novalocal container-server[83613]: Started child 83662 from parent 83613 Feb 20 19:15:17 np0005625471.novalocal container-server[83613]: Started child 83663 from parent 83613 Feb 20 19:15:17 np0005625471.novalocal container-server[83613]: Started child 83664 from parent 83613 Feb 20 19:15:17 np0005625471.novalocal container-server[83613]: Started child 83665 from parent 83613 Feb 20 19:15:18 np0005625471.novalocal systemd-rc-local-generator[83685]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:18 np0005625471.novalocal systemd-sysv-generator[83688]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:18 np0005625471.novalocal sshd-session[83661]: Received disconnect from 38.102.83.198 port 58328:11: disconnected by user Feb 20 19:15:18 np0005625471.novalocal sshd-session[83661]: Disconnected from user root 38.102.83.198 port 58328 Feb 20 19:15:18 np0005625471.novalocal sshd-session[83618]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:18 np0005625471.novalocal systemd[1]: session-126.scope: Deactivated successfully. Feb 20 19:15:18 np0005625471.novalocal systemd-logind[833]: Session 126 logged out. Waiting for processes to exit. Feb 20 19:15:18 np0005625471.novalocal systemd-logind[833]: Removed session 126. Feb 20 19:15:18 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:18 np0005625471.novalocal systemd-rc-local-generator[83749]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:18 np0005625471.novalocal systemd-sysv-generator[83754]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:18 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Container Replicator. Feb 20 19:15:18 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:18 np0005625471.novalocal systemd-rc-local-generator[83792]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:18 np0005625471.novalocal systemd-sysv-generator[83796]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:19 np0005625471.novalocal container-server[83768]: Starting 83768 Feb 20 19:15:19 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:19 np0005625471.novalocal systemd-rc-local-generator[83826]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:19 np0005625471.novalocal systemd-sysv-generator[83831]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:19 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:19 np0005625471.novalocal systemd-sysv-generator[83873]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:19 np0005625471.novalocal systemd-rc-local-generator[83870]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:19 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Container Auditor. Feb 20 19:15:19 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:20 np0005625471.novalocal systemd-rc-local-generator[83906]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:20 np0005625471.novalocal container-server[83885]: Starting 83885 Feb 20 19:15:20 np0005625471.novalocal systemd-sysv-generator[83911]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:20 np0005625471.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Feb 20 19:15:20 np0005625471.novalocal systemd[1]: setroubleshootd.service: Consumed 1.224s CPU time. Feb 20 19:15:20 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@0.service: Deactivated successfully. Feb 20 19:15:20 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@0.service: Consumed 1.102s CPU time. Feb 20 19:15:20 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:20 np0005625471.novalocal systemd-rc-local-generator[83944]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:20 np0005625471.novalocal systemd-sysv-generator[83947]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:20 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:20 np0005625471.novalocal systemd-sysv-generator[83986]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:20 np0005625471.novalocal systemd-rc-local-generator[83983]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:20 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Object Server. Feb 20 19:15:21 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:21 np0005625471.novalocal systemd-rc-local-generator[84024]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:21 np0005625471.novalocal systemd-sysv-generator[84029]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:21 np0005625471.novalocal sshd-session[84038]: Accepted publickey for root from 38.102.83.198 port 38780 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:21 np0005625471.novalocal systemd-logind[833]: New session 127 of user root. Feb 20 19:15:21 np0005625471.novalocal systemd[1]: Started Session 127 of User root. Feb 20 19:15:21 np0005625471.novalocal sshd-session[84038]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:21 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:21 np0005625471.novalocal systemd-sysv-generator[84078]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:21 np0005625471.novalocal systemd-rc-local-generator[84072]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:21 np0005625471.novalocal object-server[84002]: Started child 84113 from parent 84002 Feb 20 19:15:21 np0005625471.novalocal object-server[84002]: Started child 84116 from parent 84002 Feb 20 19:15:21 np0005625471.novalocal object-server[84002]: Started child 84117 from parent 84002 Feb 20 19:15:21 np0005625471.novalocal object-server[84002]: Started child 84118 from parent 84002 Feb 20 19:15:21 np0005625471.novalocal sshd-session[84048]: Received disconnect from 38.102.83.198 port 38780:11: disconnected by user Feb 20 19:15:21 np0005625471.novalocal sshd-session[84048]: Disconnected from user root 38.102.83.198 port 38780 Feb 20 19:15:21 np0005625471.novalocal sshd-session[84038]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:21 np0005625471.novalocal systemd[1]: session-127.scope: Deactivated successfully. Feb 20 19:15:21 np0005625471.novalocal systemd-logind[833]: Session 127 logged out. Waiting for processes to exit. Feb 20 19:15:21 np0005625471.novalocal systemd-logind[833]: Removed session 127. Feb 20 19:15:21 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:21 np0005625471.novalocal systemd-rc-local-generator[84140]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:21 np0005625471.novalocal systemd-sysv-generator[84145]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:21 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Object Replicator. Feb 20 19:15:22 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:22 np0005625471.novalocal systemd-rc-local-generator[84179]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:22 np0005625471.novalocal systemd-sysv-generator[84182]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:22 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:22 np0005625471.novalocal object-server[84159]: Starting 84159 Feb 20 19:15:22 np0005625471.novalocal systemd-sysv-generator[84223]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:22 np0005625471.novalocal object-server[84159]: Starting object replicator in daemon mode. Feb 20 19:15:22 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:15:22 np0005625471.novalocal systemd-rc-local-generator[84219]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:22 np0005625471.novalocal object-server[84159]: Nothing replicated for 0.017018556594848633 seconds. Feb 20 19:15:22 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:15:22 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:22 np0005625471.novalocal systemd-sysv-generator[84262]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:22 np0005625471.novalocal systemd-rc-local-generator[84259]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:22 np0005625471.novalocal systemd[1]: Started OpenStack Object Storage (swift) - Object Auditor. Feb 20 19:15:23 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:23 np0005625471.novalocal systemd-sysv-generator[84300]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:23 np0005625471.novalocal systemd-rc-local-generator[84295]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:23 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:23 np0005625471.novalocal systemd-sysv-generator[84341]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:23 np0005625471.novalocal object-server[84278]: Starting 84278 Feb 20 19:15:23 np0005625471.novalocal systemd-rc-local-generator[84337]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:23 np0005625471.novalocal object-server[84357]: Begin object audit "forever" mode (ZBF) Feb 20 19:15:23 np0005625471.novalocal object-server[84357]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:15:23 np0005625471.novalocal object-server[84358]: Begin object audit "forever" mode (ALL) Feb 20 19:15:23 np0005625471.novalocal object-server[84358]: Object audit (ALL) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:15:23 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:23 np0005625471.novalocal systemd-rc-local-generator[84380]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:23 np0005625471.novalocal systemd-sysv-generator[84383]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:23 np0005625471.novalocal systemd[1]: Started OpenStack Image Service (code-named Glance) API server. Feb 20 19:15:24 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:24 np0005625471.novalocal systemd-rc-local-generator[84418]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:24 np0005625471.novalocal systemd-sysv-generator[84421]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:24 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:24 np0005625471.novalocal systemd-rc-local-generator[84456]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:24 np0005625471.novalocal systemd-sysv-generator[84460]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:24 np0005625471.novalocal sshd-session[84470]: Accepted publickey for root from 38.102.83.198 port 38790 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:24 np0005625471.novalocal systemd-logind[833]: New session 128 of user root. Feb 20 19:15:24 np0005625471.novalocal systemd[1]: Started Session 128 of User root. Feb 20 19:15:24 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:24 np0005625471.novalocal systemd-sysv-generator[84501]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:24 np0005625471.novalocal systemd-rc-local-generator[84496]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:24 np0005625471.novalocal sshd-session[84470]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:24 np0005625471.novalocal sshd-session[84516]: Received disconnect from 38.102.83.198 port 38790:11: disconnected by user Feb 20 19:15:24 np0005625471.novalocal sshd-session[84516]: Disconnected from user root 38.102.83.198 port 38790 Feb 20 19:15:24 np0005625471.novalocal sshd-session[84470]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:24 np0005625471.novalocal systemd[1]: session-128.scope: Deactivated successfully. Feb 20 19:15:24 np0005625471.novalocal systemd-logind[833]: Session 128 logged out. Waiting for processes to exit. Feb 20 19:15:24 np0005625471.novalocal systemd-logind[833]: Removed session 128. Feb 20 19:15:25 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:25 np0005625471.novalocal systemd-rc-local-generator[84565]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:25 np0005625471.novalocal systemd-sysv-generator[84571]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:25 np0005625471.novalocal systemd[1]: Listening on Erlang Port Mapper Daemon Activation Socket. Feb 20 19:15:25 np0005625471.novalocal systemd[1]: Starting RabbitMQ broker... Feb 20 19:15:25 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:25.842863-05:00 [warning] <0.129.0> Both old (.config) and new (.conf) format config files exist. Feb 20 19:15:25 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:25.851881-05:00 [warning] <0.129.0> Using the old format config file: /etc/rabbitmq/rabbitmq.config Feb 20 19:15:25 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:25.851915-05:00 [warning] <0.129.0> Please update your config files to the new format and remove the old file. Feb 20 19:15:26 np0005625471.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Feb 20 19:15:26 np0005625471.novalocal systemd[1]: Starting Erlang Port Mapper Daemon... Feb 20 19:15:26 np0005625471.novalocal systemd[1]: Started Erlang Port Mapper Daemon. Feb 20 19:15:26 np0005625471.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Feb 20 19:15:27 np0005625471.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@1.service. Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.210710-05:00 [info] <0.229.0> Feature flags: list of feature flags found: Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.210800-05:00 [info] <0.229.0> Feature flags: [ ] implicit_default_bindings Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.210856-05:00 [info] <0.229.0> Feature flags: [ ] maintenance_mode_status Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.210898-05:00 [info] <0.229.0> Feature flags: [ ] quorum_queue Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.211077-05:00 [info] <0.229.0> Feature flags: [ ] stream_queue Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.211117-05:00 [info] <0.229.0> Feature flags: [ ] user_limits Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.211148-05:00 [info] <0.229.0> Feature flags: [ ] virtual_host_metadata Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.211262-05:00 [info] <0.229.0> Feature flags: feature flag states written to disk: yes Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.451311-05:00 [notice] <0.44.0> Application syslog exited with reason: stopped Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: 2026-02-20 19:15:27.451405-05:00 [notice] <0.229.0> Logging: switching to configured handler(s); following messages may not be visible in this log output Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: ## ## RabbitMQ 3.9.21 Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: ## ## Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: ########## Copyright (c) 2007-2022 VMware, Inc. or its affiliates. Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: ###### ## Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: ########## Licensed under the MPL 2.0. Website: https://rabbitmq.com Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: Erlang: 24.3.4.2 [jit] Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: TLS Library: OpenSSL - OpenSSL 3.5.5 27 Jan 2026 Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: Doc guides: https://rabbitmq.com/documentation.html Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: Support: https://rabbitmq.com/contact.html Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: Tutorials: https://rabbitmq.com/getstarted.html Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: Monitoring: https://rabbitmq.com/monitoring.html Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: Logs: /var/log/rabbitmq/rabbit@np0005625471.log Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: /var/log/rabbitmq/rabbit@np0005625471_upgrade.log Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: Feb 20 19:15:27 np0005625471.novalocal rabbitmq-server[84586]: Config file(s): /etc/rabbitmq/rabbitmq.config Feb 20 19:15:28 np0005625471.novalocal sshd-session[84682]: Accepted publickey for root from 38.102.83.198 port 38796 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:28 np0005625471.novalocal systemd-logind[833]: New session 129 of user root. Feb 20 19:15:28 np0005625471.novalocal systemd[1]: Started Session 129 of User root. Feb 20 19:15:28 np0005625471.novalocal sshd-session[84682]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. For complete SELinux messages run: sealert -l 39d88d93-7fb1-40fc-82e1-0c937ebc8cc8 Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the hostname file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:28 np0005625471.novalocal sshd-session[84685]: Received disconnect from 38.102.83.198 port 38796:11: disconnected by user Feb 20 19:15:28 np0005625471.novalocal sshd-session[84685]: Disconnected from user root 38.102.83.198 port 38796 Feb 20 19:15:28 np0005625471.novalocal sshd-session[84682]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:28 np0005625471.novalocal systemd[1]: session-129.scope: Deactivated successfully. Feb 20 19:15:28 np0005625471.novalocal systemd-logind[833]: Session 129 logged out. Waiting for processes to exit. Feb 20 19:15:28 np0005625471.novalocal systemd-logind[833]: Removed session 129. Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. For complete SELinux messages run: sealert -l 19a2d4d3-872f-46f2-b8a2-4d833445fe50 Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the rpm file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. For complete SELinux messages run: sealert -l 51e108a8-438c-4ae5-a756-a4b8cfc3c0e4 Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the gpg file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l a6759932-cc8d-4628-9509-48ddca439685 Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. For complete SELinux messages run: sealert -l 2628dcfa-22b8-4c18-9ad5-f9b79810eeee Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the dnf-utils file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. For complete SELinux messages run: sealert -l a4a15689-2bb6-4011-a07d-fd122f1f354a Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the traceroute file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. For complete SELinux messages run: sealert -l dafa9fe3-99a3-4eeb-9876-970f5802aadb Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the consolehelper file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. For complete SELinux messages run: sealert -l fb5fe8d6-43a1-48e3-8cbc-5ac207a63b81 Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadb-backup file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. For complete SELinux messages run: sealert -l 4d541ce2-919f-485f-abb1-9d5df48f0c7e Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadbd-safe file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. For complete SELinux messages run: sealert -l 30b4103f-7ef6-4aad-8655-0a362fa852de Feb 20 19:15:28 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the keepalived file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'glance-api' --raw | audit2allow -M my-glanceapi # semodule -X 300 -i my-glanceapi.pp Feb 20 19:15:30 np0005625471.novalocal rabbitmq-server[84586]: Starting broker... completed with 0 plugins. Feb 20 19:15:30 np0005625471.novalocal systemd[1]: Started RabbitMQ broker. Feb 20 19:15:30 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:30 np0005625471.novalocal systemd-rc-local-generator[84748]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:30 np0005625471.novalocal systemd-sysv-generator[84753]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:30 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:30 np0005625471.novalocal systemd-rc-local-generator[84783]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:30 np0005625471.novalocal systemd-sysv-generator[84787]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:30 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:31 np0005625471.novalocal systemd-rc-local-generator[84822]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:31 np0005625471.novalocal systemd-sysv-generator[84825]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:31 np0005625471.novalocal systemd[1]: Starting OpenStack Neutron Server... Feb 20 19:15:31 np0005625471.novalocal sshd-session[84846]: Accepted publickey for root from 38.102.83.198 port 44416 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:31 np0005625471.novalocal systemd-logind[833]: New session 130 of user root. Feb 20 19:15:31 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:15:31 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:15:31 np0005625471.novalocal container-server[83768]: Attempted to replicate 0 dbs in 0.00119 seconds (0.00000/s) Feb 20 19:15:31 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:15:31 np0005625471.novalocal container-server[83768]: 0 successes, 0 failures Feb 20 19:15:31 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:15:31 np0005625471.novalocal systemd[1]: Started Session 130 of User root. Feb 20 19:15:31 np0005625471.novalocal sshd-session[84846]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:31 np0005625471.novalocal sshd-session[84849]: Received disconnect from 38.102.83.198 port 44416:11: disconnected by user Feb 20 19:15:31 np0005625471.novalocal sshd-session[84849]: Disconnected from user root 38.102.83.198 port 44416 Feb 20 19:15:31 np0005625471.novalocal sshd-session[84846]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:31 np0005625471.novalocal systemd[1]: session-130.scope: Deactivated successfully. Feb 20 19:15:31 np0005625471.novalocal systemd-logind[833]: Session 130 logged out. Waiting for processes to exit. Feb 20 19:15:31 np0005625471.novalocal systemd-logind[833]: Removed session 130. Feb 20 19:15:32 np0005625471.novalocal account-server[83496]: Begin account audit pass. Feb 20 19:15:32 np0005625471.novalocal account-server[83496]: Account audit pass completed: 0.00s Feb 20 19:15:33 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b492958-8ac4-44ad-bbb8-280146680694 Feb 20 19:15:33 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Feb 20 19:15:33 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b492958-8ac4-44ad-bbb8-280146680694 Feb 20 19:15:33 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Feb 20 19:15:33 np0005625471.novalocal systemd[1]: Started OpenStack Neutron Server. Feb 20 19:15:33 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:33 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:15:33 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:15:33 np0005625471.novalocal account-server[83378]: Attempted to replicate 0 dbs in 0.00124 seconds (0.00000/s) Feb 20 19:15:33 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:15:33 np0005625471.novalocal account-server[83378]: 0 successes, 0 failures Feb 20 19:15:33 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:15:33 np0005625471.novalocal systemd-sysv-generator[84909]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:33 np0005625471.novalocal systemd-rc-local-generator[84904]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:33 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:34 np0005625471.novalocal systemd-sysv-generator[84949]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:34 np0005625471.novalocal systemd-rc-local-generator[84946]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:34 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:34 np0005625471.novalocal sshd-session[84970]: Accepted publickey for root from 38.102.83.198 port 44418 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:34 np0005625471.novalocal systemd-rc-local-generator[84990]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:34 np0005625471.novalocal systemd-sysv-generator[84993]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:34 np0005625471.novalocal systemd-logind[833]: New session 131 of user root. Feb 20 19:15:34 np0005625471.novalocal systemd[1]: Started Session 131 of User root. Feb 20 19:15:34 np0005625471.novalocal sshd-session[84970]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:34 np0005625471.novalocal systemd[1]: Starting The Apache HTTP Server... Feb 20 19:15:34 np0005625471.novalocal httpd[85010]: Server configured, listening on: port 80, port 5000, ... Feb 20 19:15:34 np0005625471.novalocal systemd[1]: Started The Apache HTTP Server. Feb 20 19:15:34 np0005625471.novalocal sshd-session[85009]: Received disconnect from 38.102.83.198 port 44418:11: disconnected by user Feb 20 19:15:34 np0005625471.novalocal sshd-session[85009]: Disconnected from user root 38.102.83.198 port 44418 Feb 20 19:15:34 np0005625471.novalocal sshd-session[84970]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:34 np0005625471.novalocal systemd[1]: session-131.scope: Deactivated successfully. Feb 20 19:15:34 np0005625471.novalocal systemd-logind[833]: Session 131 logged out. Waiting for processes to exit. Feb 20 19:15:34 np0005625471.novalocal systemd-logind[833]: Removed session 131. Feb 20 19:15:35 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:35 np0005625471.novalocal systemd-sysv-generator[85097]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:35 np0005625471.novalocal systemd-rc-local-generator[85094]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:35 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:15:35 np0005625471.novalocal systemd-rc-local-generator[85133]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:15:35 np0005625471.novalocal systemd-sysv-generator[85136]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:15:35 np0005625471.novalocal crontab[85151]: (root) REPLACE (keystone) Feb 20 19:15:37 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/sbin/httpd from write access on the directory /var/lib/keystone/(null). For complete SELinux messages run: sealert -l a556e115-45c6-4125-8e14-86753d582a49 Feb 20 19:15:37 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/sbin/httpd from write access on the directory /var/lib/keystone/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed write access on the (null) directory by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:15:37 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/sbin/httpd from add_name access on the directory /var/lib/keystone/(null). For complete SELinux messages run: sealert -l 3fb4fd87-80aa-4f7a-a988-da0bc57a2d3e Feb 20 19:15:37 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/sbin/httpd from add_name access on the directory /var/lib/keystone/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed add_name access on the (null) directory by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:15:37 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/sbin/httpd from create access on the file /var/lib/keystone/(null). For complete SELinux messages run: sealert -l 1f3ce9cf-7b9d-4b9e-8edc-b08cc21a9e11 Feb 20 19:15:37 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/sbin/httpd from create access on the file /var/lib/keystone/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed create access on the (null) file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:15:37 np0005625471.novalocal setroubleshoot[84664]: failed to retrieve rpm info for path '/var/lib/keystone/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13': Feb 20 19:15:37 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/sbin/httpd from write access on the file /var/lib/keystone/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. For complete SELinux messages run: sealert -l ddff08de-62e3-496f-ba4d-fef49e796c4f Feb 20 19:15:37 np0005625471.novalocal setroubleshoot[84664]: SELinux is preventing /usr/sbin/httpd from write access on the file /var/lib/keystone/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed write access on the 3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:15:38 np0005625471.novalocal sshd-session[85161]: Accepted publickey for root from 38.102.83.198 port 44426 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:38 np0005625471.novalocal systemd-logind[833]: New session 132 of user root. Feb 20 19:15:38 np0005625471.novalocal systemd[1]: Started Session 132 of User root. Feb 20 19:15:38 np0005625471.novalocal sshd-session[85161]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:38 np0005625471.novalocal sshd-session[85164]: Received disconnect from 38.102.83.198 port 44426:11: disconnected by user Feb 20 19:15:38 np0005625471.novalocal sshd-session[85164]: Disconnected from user root 38.102.83.198 port 44426 Feb 20 19:15:38 np0005625471.novalocal sshd-session[85161]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:38 np0005625471.novalocal systemd[1]: session-132.scope: Deactivated successfully. Feb 20 19:15:38 np0005625471.novalocal systemd-logind[833]: Session 132 logged out. Waiting for processes to exit. Feb 20 19:15:38 np0005625471.novalocal systemd-logind[833]: Removed session 132. Feb 20 19:15:41 np0005625471.novalocal sshd-session[85199]: Accepted publickey for root from 38.102.83.198 port 54742 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:41 np0005625471.novalocal systemd-logind[833]: New session 133 of user root. Feb 20 19:15:41 np0005625471.novalocal systemd[1]: Started Session 133 of User root. Feb 20 19:15:41 np0005625471.novalocal sshd-session[85199]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:41 np0005625471.novalocal sshd-session[85202]: Received disconnect from 38.102.83.198 port 54742:11: disconnected by user Feb 20 19:15:41 np0005625471.novalocal sshd-session[85202]: Disconnected from user root 38.102.83.198 port 54742 Feb 20 19:15:41 np0005625471.novalocal sshd-session[85199]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:41 np0005625471.novalocal systemd[1]: session-133.scope: Deactivated successfully. Feb 20 19:15:41 np0005625471.novalocal systemd-logind[833]: Session 133 logged out. Waiting for processes to exit. Feb 20 19:15:41 np0005625471.novalocal systemd-logind[833]: Removed session 133. Feb 20 19:15:43 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:15:43 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.00020956993103027344 seconds. Feb 20 19:15:43 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:15:44 np0005625471.novalocal sshd-session[85236]: Accepted publickey for root from 38.102.83.198 port 54754 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:44 np0005625471.novalocal systemd-logind[833]: New session 134 of user root. Feb 20 19:15:44 np0005625471.novalocal systemd[1]: Started Session 134 of User root. Feb 20 19:15:44 np0005625471.novalocal sshd-session[85236]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:44 np0005625471.novalocal sshd-session[85239]: Received disconnect from 38.102.83.198 port 54754:11: disconnected by user Feb 20 19:15:44 np0005625471.novalocal sshd-session[85239]: Disconnected from user root 38.102.83.198 port 54754 Feb 20 19:15:44 np0005625471.novalocal sshd-session[85236]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:44 np0005625471.novalocal systemd[1]: session-134.scope: Deactivated successfully. Feb 20 19:15:44 np0005625471.novalocal systemd-logind[833]: Session 134 logged out. Waiting for processes to exit. Feb 20 19:15:44 np0005625471.novalocal systemd-logind[833]: Removed session 134. Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Found no containers directories Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:46 2026 visited - attempted:0 success:0 failure:0 skipped:0 completed:0 Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:46 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:46 2026 created - attempted:0 success:0 failure:0 Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:46 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:46 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:46 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:15:46 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:15:46 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.00s Feb 20 19:15:47 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@1.service: Deactivated successfully. Feb 20 19:15:47 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@1.service: Consumed 1.162s CPU time. Feb 20 19:15:47 np0005625471.novalocal systemd[1]: Starting Cleanup of Temporary Directories... Feb 20 19:15:47 np0005625471.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Feb 20 19:15:47 np0005625471.novalocal systemd[1]: setroubleshootd.service: Consumed 1.507s CPU time. Feb 20 19:15:47 np0005625471.novalocal sshd-session[85273]: Accepted publickey for root from 38.102.83.198 port 54756 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:47 np0005625471.novalocal systemd-logind[833]: New session 135 of user root. Feb 20 19:15:47 np0005625471.novalocal systemd[1]: Started Session 135 of User root. Feb 20 19:15:47 np0005625471.novalocal systemd[1]: systemd-tmpfiles-clean.service: Deactivated successfully. Feb 20 19:15:47 np0005625471.novalocal systemd[1]: Finished Cleanup of Temporary Directories. Feb 20 19:15:47 np0005625471.novalocal systemd[1]: run-credentials-systemd\x2dtmpfiles\x2dclean.service.mount: Deactivated successfully. Feb 20 19:15:47 np0005625471.novalocal sshd-session[85273]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:47 np0005625471.novalocal sshd-session[85276]: Received disconnect from 38.102.83.198 port 54756:11: disconnected by user Feb 20 19:15:47 np0005625471.novalocal sshd-session[85276]: Disconnected from user root 38.102.83.198 port 54756 Feb 20 19:15:47 np0005625471.novalocal sshd-session[85273]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:47 np0005625471.novalocal systemd-logind[833]: Session 135 logged out. Waiting for processes to exit. Feb 20 19:15:47 np0005625471.novalocal systemd[1]: session-135.scope: Deactivated successfully. Feb 20 19:15:47 np0005625471.novalocal systemd-logind[833]: Removed session 135. Feb 20 19:15:51 np0005625471.novalocal sshd-session[85312]: Accepted publickey for root from 38.102.83.198 port 38920 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:51 np0005625471.novalocal systemd-logind[833]: New session 136 of user root. Feb 20 19:15:51 np0005625471.novalocal systemd[1]: Started Session 136 of User root. Feb 20 19:15:51 np0005625471.novalocal sshd-session[85312]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:51 np0005625471.novalocal sshd-session[85315]: Received disconnect from 38.102.83.198 port 38920:11: disconnected by user Feb 20 19:15:51 np0005625471.novalocal sshd-session[85315]: Disconnected from user root 38.102.83.198 port 38920 Feb 20 19:15:51 np0005625471.novalocal sshd-session[85312]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:51 np0005625471.novalocal systemd[1]: session-136.scope: Deactivated successfully. Feb 20 19:15:51 np0005625471.novalocal systemd-logind[833]: Session 136 logged out. Waiting for processes to exit. Feb 20 19:15:51 np0005625471.novalocal systemd-logind[833]: Removed session 136. Feb 20 19:15:52 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:15:52 np0005625471.novalocal object-server[84159]: Nothing replicated for 0.0004937648773193359 seconds. Feb 20 19:15:52 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:15:53 np0005625471.novalocal object-server[85345]: Begin object audit "forever" mode (ALL) Feb 20 19:15:53 np0005625471.novalocal object-server[85344]: Begin object audit "forever" mode (ZBF) Feb 20 19:15:53 np0005625471.novalocal object-server[85345]: Object audit (ALL) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:15:53 np0005625471.novalocal object-server[85344]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:15:54 np0005625471.novalocal sshd-session[85349]: Accepted publickey for root from 38.102.83.198 port 38928 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:54 np0005625471.novalocal systemd-logind[833]: New session 137 of user root. Feb 20 19:15:54 np0005625471.novalocal systemd[1]: Started Session 137 of User root. Feb 20 19:15:54 np0005625471.novalocal sshd-session[85349]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:54 np0005625471.novalocal sshd-session[85352]: Received disconnect from 38.102.83.198 port 38928:11: disconnected by user Feb 20 19:15:54 np0005625471.novalocal sshd-session[85352]: Disconnected from user root 38.102.83.198 port 38928 Feb 20 19:15:54 np0005625471.novalocal sshd-session[85349]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:54 np0005625471.novalocal systemd[1]: session-137.scope: Deactivated successfully. Feb 20 19:15:54 np0005625471.novalocal systemd-logind[833]: Session 137 logged out. Waiting for processes to exit. Feb 20 19:15:54 np0005625471.novalocal systemd-logind[833]: Removed session 137. Feb 20 19:15:57 np0005625471.novalocal sshd-session[85385]: Accepted publickey for root from 38.102.83.198 port 38938 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:15:57 np0005625471.novalocal systemd-logind[833]: New session 138 of user root. Feb 20 19:15:57 np0005625471.novalocal systemd[1]: Started Session 138 of User root. Feb 20 19:15:57 np0005625471.novalocal sshd-session[85385]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:15:57 np0005625471.novalocal sshd-session[85388]: Received disconnect from 38.102.83.198 port 38938:11: disconnected by user Feb 20 19:15:57 np0005625471.novalocal sshd-session[85388]: Disconnected from user root 38.102.83.198 port 38938 Feb 20 19:15:57 np0005625471.novalocal sshd-session[85385]: pam_unix(sshd:session): session closed for user root Feb 20 19:15:57 np0005625471.novalocal systemd[1]: session-138.scope: Deactivated successfully. Feb 20 19:15:57 np0005625471.novalocal systemd-logind[833]: Session 138 logged out. Waiting for processes to exit. Feb 20 19:15:57 np0005625471.novalocal systemd-logind[833]: Removed session 138. Feb 20 19:16:00 np0005625471.novalocal sshd-session[85423]: Accepted publickey for root from 38.102.83.198 port 59274 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:00 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:16:00 np0005625471.novalocal systemd-logind[833]: New session 139 of user root. Feb 20 19:16:00 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:16:00 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:16:00 np0005625471.novalocal systemd[1]: Started Session 139 of User root. Feb 20 19:16:00 np0005625471.novalocal sshd-session[85423]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:01 np0005625471.novalocal sshd-session[85427]: Received disconnect from 38.102.83.198 port 59274:11: disconnected by user Feb 20 19:16:01 np0005625471.novalocal sshd-session[85427]: Disconnected from user root 38.102.83.198 port 59274 Feb 20 19:16:01 np0005625471.novalocal sshd-session[85423]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:01 np0005625471.novalocal systemd[1]: session-139.scope: Deactivated successfully. Feb 20 19:16:01 np0005625471.novalocal systemd-logind[833]: Session 139 logged out. Waiting for processes to exit. Feb 20 19:16:01 np0005625471.novalocal systemd-logind[833]: Removed session 139. Feb 20 19:16:01 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:16:01 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:16:01 np0005625471.novalocal container-server[83768]: Attempted to replicate 0 dbs in 0.00147 seconds (0.00000/s) Feb 20 19:16:01 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:16:01 np0005625471.novalocal container-server[83768]: 0 successes, 0 failures Feb 20 19:16:01 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:16:03 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:16:03 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:16:03 np0005625471.novalocal account-server[83378]: Attempted to replicate 0 dbs in 0.00055 seconds (0.00000/s) Feb 20 19:16:03 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:16:03 np0005625471.novalocal account-server[83378]: 0 successes, 0 failures Feb 20 19:16:03 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:16:04 np0005625471.novalocal sshd-session[85460]: Accepted publickey for root from 38.102.83.198 port 59278 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:04 np0005625471.novalocal systemd-logind[833]: New session 140 of user root. Feb 20 19:16:04 np0005625471.novalocal systemd[1]: Started Session 140 of User root. Feb 20 19:16:04 np0005625471.novalocal sshd-session[85460]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:04 np0005625471.novalocal sshd-session[85463]: Received disconnect from 38.102.83.198 port 59278:11: disconnected by user Feb 20 19:16:04 np0005625471.novalocal sshd-session[85463]: Disconnected from user root 38.102.83.198 port 59278 Feb 20 19:16:04 np0005625471.novalocal sshd-session[85460]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:04 np0005625471.novalocal systemd[1]: session-140.scope: Deactivated successfully. Feb 20 19:16:04 np0005625471.novalocal systemd-logind[833]: Session 140 logged out. Waiting for processes to exit. Feb 20 19:16:04 np0005625471.novalocal systemd-logind[833]: Removed session 140. Feb 20 19:16:07 np0005625471.novalocal sshd-session[85495]: Accepted publickey for root from 38.102.83.198 port 59280 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:07 np0005625471.novalocal systemd-logind[833]: New session 141 of user root. Feb 20 19:16:07 np0005625471.novalocal systemd[1]: Started Session 141 of User root. Feb 20 19:16:07 np0005625471.novalocal sshd-session[85495]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:07 np0005625471.novalocal sshd-session[85498]: Received disconnect from 38.102.83.198 port 59280:11: disconnected by user Feb 20 19:16:07 np0005625471.novalocal sshd-session[85498]: Disconnected from user root 38.102.83.198 port 59280 Feb 20 19:16:07 np0005625471.novalocal sshd-session[85495]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:07 np0005625471.novalocal systemd[1]: session-141.scope: Deactivated successfully. Feb 20 19:16:07 np0005625471.novalocal systemd-logind[833]: Session 141 logged out. Waiting for processes to exit. Feb 20 19:16:07 np0005625471.novalocal systemd-logind[833]: Removed session 141. Feb 20 19:16:10 np0005625471.novalocal sshd-session[85533]: Accepted publickey for root from 38.102.83.198 port 36134 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:10 np0005625471.novalocal systemd-logind[833]: New session 142 of user root. Feb 20 19:16:10 np0005625471.novalocal systemd[1]: Started Session 142 of User root. Feb 20 19:16:10 np0005625471.novalocal sshd-session[85533]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:10 np0005625471.novalocal sshd-session[85536]: Received disconnect from 38.102.83.198 port 36134:11: disconnected by user Feb 20 19:16:10 np0005625471.novalocal sshd-session[85536]: Disconnected from user root 38.102.83.198 port 36134 Feb 20 19:16:10 np0005625471.novalocal sshd-session[85533]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:10 np0005625471.novalocal systemd-logind[833]: Session 142 logged out. Waiting for processes to exit. Feb 20 19:16:10 np0005625471.novalocal systemd[1]: session-142.scope: Deactivated successfully. Feb 20 19:16:10 np0005625471.novalocal systemd-logind[833]: Removed session 142. Feb 20 19:16:13 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:16:13 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.00035762786865234375 seconds. Feb 20 19:16:13 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:16:13 np0005625471.novalocal sshd-session[85569]: Accepted publickey for root from 38.102.83.198 port 36136 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:13 np0005625471.novalocal systemd-logind[833]: New session 143 of user root. Feb 20 19:16:13 np0005625471.novalocal systemd[1]: Started Session 143 of User root. Feb 20 19:16:13 np0005625471.novalocal sshd-session[85569]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:14 np0005625471.novalocal sshd-session[85572]: Received disconnect from 38.102.83.198 port 36136:11: disconnected by user Feb 20 19:16:14 np0005625471.novalocal sshd-session[85572]: Disconnected from user root 38.102.83.198 port 36136 Feb 20 19:16:14 np0005625471.novalocal sshd-session[85569]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:14 np0005625471.novalocal systemd[1]: session-143.scope: Deactivated successfully. Feb 20 19:16:14 np0005625471.novalocal systemd-logind[833]: Session 143 logged out. Waiting for processes to exit. Feb 20 19:16:14 np0005625471.novalocal systemd-logind[833]: Removed session 143. Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Found no containers directories Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:16 2026 visited - attempted:0 success:0 failure:0 skipped:0 completed:0 Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:16 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:16 2026 created - attempted:0 success:0 failure:0 Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:16 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:16 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:16 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:16 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:16:16 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.00s Feb 20 19:16:17 np0005625471.novalocal sshd-session[85607]: Accepted publickey for root from 38.102.83.198 port 36140 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:17 np0005625471.novalocal systemd-logind[833]: New session 144 of user root. Feb 20 19:16:17 np0005625471.novalocal systemd[1]: Started Session 144 of User root. Feb 20 19:16:17 np0005625471.novalocal sshd-session[85607]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:17 np0005625471.novalocal sshd-session[85610]: Received disconnect from 38.102.83.198 port 36140:11: disconnected by user Feb 20 19:16:17 np0005625471.novalocal sshd-session[85610]: Disconnected from user root 38.102.83.198 port 36140 Feb 20 19:16:17 np0005625471.novalocal sshd-session[85607]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:17 np0005625471.novalocal systemd[1]: session-144.scope: Deactivated successfully. Feb 20 19:16:17 np0005625471.novalocal systemd-logind[833]: Session 144 logged out. Waiting for processes to exit. Feb 20 19:16:17 np0005625471.novalocal systemd-logind[833]: Removed session 144. Feb 20 19:16:20 np0005625471.novalocal sshd-session[85644]: Accepted publickey for root from 38.102.83.198 port 42820 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:20 np0005625471.novalocal systemd-logind[833]: New session 145 of user root. Feb 20 19:16:20 np0005625471.novalocal systemd[1]: Started Session 145 of User root. Feb 20 19:16:20 np0005625471.novalocal sshd-session[85644]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:20 np0005625471.novalocal sshd-session[85647]: Received disconnect from 38.102.83.198 port 42820:11: disconnected by user Feb 20 19:16:20 np0005625471.novalocal sshd-session[85647]: Disconnected from user root 38.102.83.198 port 42820 Feb 20 19:16:20 np0005625471.novalocal sshd-session[85644]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:20 np0005625471.novalocal systemd[1]: session-145.scope: Deactivated successfully. Feb 20 19:16:20 np0005625471.novalocal systemd-logind[833]: Session 145 logged out. Waiting for processes to exit. Feb 20 19:16:20 np0005625471.novalocal systemd-logind[833]: Removed session 145. Feb 20 19:16:22 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:16:22 np0005625471.novalocal object-server[84159]: Nothing replicated for 0.0009281635284423828 seconds. Feb 20 19:16:22 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:16:23 np0005625471.novalocal object-server[85677]: Begin object audit "forever" mode (ALL) Feb 20 19:16:23 np0005625471.novalocal object-server[85677]: Object audit (ALL) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:16:23 np0005625471.novalocal object-server[85676]: Begin object audit "forever" mode (ZBF) Feb 20 19:16:23 np0005625471.novalocal object-server[85676]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:16:23 np0005625471.novalocal sshd-session[85681]: Accepted publickey for root from 38.102.83.198 port 42836 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:23 np0005625471.novalocal systemd-logind[833]: New session 146 of user root. Feb 20 19:16:23 np0005625471.novalocal systemd[1]: Started Session 146 of User root. Feb 20 19:16:23 np0005625471.novalocal sshd-session[85681]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:23 np0005625471.novalocal sshd-session[85684]: Received disconnect from 38.102.83.198 port 42836:11: disconnected by user Feb 20 19:16:23 np0005625471.novalocal sshd-session[85684]: Disconnected from user root 38.102.83.198 port 42836 Feb 20 19:16:23 np0005625471.novalocal sshd-session[85681]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:23 np0005625471.novalocal systemd-logind[833]: Session 146 logged out. Waiting for processes to exit. Feb 20 19:16:23 np0005625471.novalocal systemd[1]: session-146.scope: Deactivated successfully. Feb 20 19:16:23 np0005625471.novalocal systemd-logind[833]: Removed session 146. Feb 20 19:16:26 np0005625471.novalocal sshd-session[85717]: Accepted publickey for root from 38.102.83.198 port 42844 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:26 np0005625471.novalocal systemd-logind[833]: New session 147 of user root. Feb 20 19:16:26 np0005625471.novalocal systemd[1]: Started Session 147 of User root. Feb 20 19:16:26 np0005625471.novalocal sshd-session[85717]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:27 np0005625471.novalocal sshd-session[85720]: Received disconnect from 38.102.83.198 port 42844:11: disconnected by user Feb 20 19:16:27 np0005625471.novalocal sshd-session[85720]: Disconnected from user root 38.102.83.198 port 42844 Feb 20 19:16:27 np0005625471.novalocal sshd-session[85717]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:27 np0005625471.novalocal systemd[1]: session-147.scope: Deactivated successfully. Feb 20 19:16:27 np0005625471.novalocal systemd-logind[833]: Session 147 logged out. Waiting for processes to exit. Feb 20 19:16:27 np0005625471.novalocal systemd-logind[833]: Removed session 147. Feb 20 19:16:30 np0005625471.novalocal sshd-session[85790]: Accepted publickey for root from 38.102.83.198 port 55696 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:30 np0005625471.novalocal systemd-logind[833]: New session 148 of user root. Feb 20 19:16:30 np0005625471.novalocal systemd[1]: Started Session 148 of User root. Feb 20 19:16:30 np0005625471.novalocal sshd-session[85790]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:30 np0005625471.novalocal sshd-session[85793]: Received disconnect from 38.102.83.198 port 55696:11: disconnected by user Feb 20 19:16:30 np0005625471.novalocal sshd-session[85793]: Disconnected from user root 38.102.83.198 port 55696 Feb 20 19:16:30 np0005625471.novalocal sshd-session[85790]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:30 np0005625471.novalocal systemd[1]: session-148.scope: Deactivated successfully. Feb 20 19:16:30 np0005625471.novalocal systemd-logind[833]: Session 148 logged out. Waiting for processes to exit. Feb 20 19:16:30 np0005625471.novalocal systemd-logind[833]: Removed session 148. Feb 20 19:16:31 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:16:31 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:16:31 np0005625471.novalocal container-server[83768]: Attempted to replicate 0 dbs in 0.00076 seconds (0.00000/s) Feb 20 19:16:31 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:16:31 np0005625471.novalocal container-server[83768]: 0 successes, 0 failures Feb 20 19:16:31 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:16:33 np0005625471.novalocal sshd-session[85826]: Accepted publickey for root from 38.102.83.198 port 55708 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:33 np0005625471.novalocal systemd-logind[833]: New session 149 of user root. Feb 20 19:16:33 np0005625471.novalocal systemd[1]: Started Session 149 of User root. Feb 20 19:16:33 np0005625471.novalocal sshd-session[85826]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:33 np0005625471.novalocal sshd-session[85829]: Received disconnect from 38.102.83.198 port 55708:11: disconnected by user Feb 20 19:16:33 np0005625471.novalocal sshd-session[85829]: Disconnected from user root 38.102.83.198 port 55708 Feb 20 19:16:33 np0005625471.novalocal sshd-session[85826]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:33 np0005625471.novalocal systemd-logind[833]: Session 149 logged out. Waiting for processes to exit. Feb 20 19:16:33 np0005625471.novalocal systemd[1]: session-149.scope: Deactivated successfully. Feb 20 19:16:33 np0005625471.novalocal systemd-logind[833]: Removed session 149. Feb 20 19:16:33 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:16:33 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:16:33 np0005625471.novalocal account-server[83378]: Attempted to replicate 0 dbs in 0.00059 seconds (0.00000/s) Feb 20 19:16:33 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:16:33 np0005625471.novalocal account-server[83378]: 0 successes, 0 failures Feb 20 19:16:33 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:16:36 np0005625471.novalocal sshd-session[85861]: Accepted publickey for root from 38.102.83.198 port 55712 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:36 np0005625471.novalocal systemd-logind[833]: New session 150 of user root. Feb 20 19:16:36 np0005625471.novalocal systemd[1]: Started Session 150 of User root. Feb 20 19:16:36 np0005625471.novalocal sshd-session[85861]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:36 np0005625471.novalocal sshd-session[85864]: Received disconnect from 38.102.83.198 port 55712:11: disconnected by user Feb 20 19:16:36 np0005625471.novalocal sshd-session[85864]: Disconnected from user root 38.102.83.198 port 55712 Feb 20 19:16:36 np0005625471.novalocal sshd-session[85861]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:36 np0005625471.novalocal systemd[1]: session-150.scope: Deactivated successfully. Feb 20 19:16:36 np0005625471.novalocal systemd-logind[833]: Session 150 logged out. Waiting for processes to exit. Feb 20 19:16:36 np0005625471.novalocal systemd-logind[833]: Removed session 150. Feb 20 19:16:39 np0005625471.novalocal sshd-session[85898]: Accepted publickey for root from 38.102.83.198 port 52208 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:39 np0005625471.novalocal systemd-logind[833]: New session 151 of user root. Feb 20 19:16:39 np0005625471.novalocal systemd[1]: Started Session 151 of User root. Feb 20 19:16:39 np0005625471.novalocal sshd-session[85898]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:40 np0005625471.novalocal sshd-session[85901]: Received disconnect from 38.102.83.198 port 52208:11: disconnected by user Feb 20 19:16:40 np0005625471.novalocal sshd-session[85901]: Disconnected from user root 38.102.83.198 port 52208 Feb 20 19:16:40 np0005625471.novalocal sshd-session[85898]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:40 np0005625471.novalocal systemd[1]: session-151.scope: Deactivated successfully. Feb 20 19:16:40 np0005625471.novalocal systemd-logind[833]: Session 151 logged out. Waiting for processes to exit. Feb 20 19:16:40 np0005625471.novalocal systemd-logind[833]: Removed session 151. Feb 20 19:16:43 np0005625471.novalocal sshd-session[85934]: Accepted publickey for root from 38.102.83.198 port 52218 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:43 np0005625471.novalocal systemd-logind[833]: New session 152 of user root. Feb 20 19:16:43 np0005625471.novalocal systemd[1]: Started Session 152 of User root. Feb 20 19:16:43 np0005625471.novalocal sshd-session[85934]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:43 np0005625471.novalocal sshd-session[85937]: Received disconnect from 38.102.83.198 port 52218:11: disconnected by user Feb 20 19:16:43 np0005625471.novalocal sshd-session[85937]: Disconnected from user root 38.102.83.198 port 52218 Feb 20 19:16:43 np0005625471.novalocal sshd-session[85934]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:43 np0005625471.novalocal systemd[1]: session-152.scope: Deactivated successfully. Feb 20 19:16:43 np0005625471.novalocal systemd-logind[833]: Session 152 logged out. Waiting for processes to exit. Feb 20 19:16:43 np0005625471.novalocal systemd-logind[833]: Removed session 152. Feb 20 19:16:43 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:16:43 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.0002167224884033203 seconds. Feb 20 19:16:43 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:16:46 np0005625471.novalocal sshd-session[85969]: Accepted publickey for root from 38.102.83.198 port 52224 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:46 np0005625471.novalocal systemd-logind[833]: New session 153 of user root. Feb 20 19:16:46 np0005625471.novalocal systemd[1]: Started Session 153 of User root. Feb 20 19:16:46 np0005625471.novalocal sshd-session[85969]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:46 np0005625471.novalocal sshd-session[85972]: Received disconnect from 38.102.83.198 port 52224:11: disconnected by user Feb 20 19:16:46 np0005625471.novalocal sshd-session[85972]: Disconnected from user root 38.102.83.198 port 52224 Feb 20 19:16:46 np0005625471.novalocal sshd-session[85969]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:46 np0005625471.novalocal systemd[1]: session-153.scope: Deactivated successfully. Feb 20 19:16:46 np0005625471.novalocal systemd-logind[833]: Session 153 logged out. Waiting for processes to exit. Feb 20 19:16:46 np0005625471.novalocal systemd-logind[833]: Removed session 153. Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Found no containers directories Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:46 2026 visited - attempted:0 success:0 failure:0 skipped:0 completed:0 Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:46 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:46 2026 created - attempted:0 success:0 failure:0 Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:46 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:46 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:46 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:16:46 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:16:46 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.00s Feb 20 19:16:49 np0005625471.novalocal sshd-session[86007]: Accepted publickey for root from 38.102.83.198 port 52728 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:49 np0005625471.novalocal systemd-logind[833]: New session 154 of user root. Feb 20 19:16:49 np0005625471.novalocal systemd[1]: Started Session 154 of User root. Feb 20 19:16:49 np0005625471.novalocal sshd-session[86007]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:49 np0005625471.novalocal sshd-session[86010]: Received disconnect from 38.102.83.198 port 52728:11: disconnected by user Feb 20 19:16:49 np0005625471.novalocal sshd-session[86010]: Disconnected from user root 38.102.83.198 port 52728 Feb 20 19:16:49 np0005625471.novalocal sshd-session[86007]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:49 np0005625471.novalocal systemd-logind[833]: Session 154 logged out. Waiting for processes to exit. Feb 20 19:16:49 np0005625471.novalocal systemd[1]: session-154.scope: Deactivated successfully. Feb 20 19:16:49 np0005625471.novalocal systemd-logind[833]: Removed session 154. Feb 20 19:16:52 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:16:52 np0005625471.novalocal object-server[84159]: Nothing replicated for 0.00042629241943359375 seconds. Feb 20 19:16:52 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:16:52 np0005625471.novalocal sshd-session[86043]: Accepted publickey for root from 38.102.83.198 port 52732 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:52 np0005625471.novalocal systemd-logind[833]: New session 155 of user root. Feb 20 19:16:52 np0005625471.novalocal systemd[1]: Started Session 155 of User root. Feb 20 19:16:52 np0005625471.novalocal sshd-session[86043]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:53 np0005625471.novalocal sshd-session[86046]: Received disconnect from 38.102.83.198 port 52732:11: disconnected by user Feb 20 19:16:53 np0005625471.novalocal sshd-session[86046]: Disconnected from user root 38.102.83.198 port 52732 Feb 20 19:16:53 np0005625471.novalocal sshd-session[86043]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:53 np0005625471.novalocal systemd[1]: session-155.scope: Deactivated successfully. Feb 20 19:16:53 np0005625471.novalocal systemd-logind[833]: Session 155 logged out. Waiting for processes to exit. Feb 20 19:16:53 np0005625471.novalocal systemd-logind[833]: Removed session 155. Feb 20 19:16:53 np0005625471.novalocal object-server[86074]: Begin object audit "forever" mode (ZBF) Feb 20 19:16:53 np0005625471.novalocal object-server[86074]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:16:53 np0005625471.novalocal object-server[86075]: Begin object audit "forever" mode (ALL) Feb 20 19:16:53 np0005625471.novalocal object-server[86075]: Object audit (ALL) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:16:56 np0005625471.novalocal sshd-session[86081]: Accepted publickey for root from 38.102.83.198 port 52738 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:56 np0005625471.novalocal systemd-logind[833]: New session 156 of user root. Feb 20 19:16:56 np0005625471.novalocal systemd[1]: Started Session 156 of User root. Feb 20 19:16:56 np0005625471.novalocal sshd-session[86081]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:56 np0005625471.novalocal sshd-session[86084]: Received disconnect from 38.102.83.198 port 52738:11: disconnected by user Feb 20 19:16:56 np0005625471.novalocal sshd-session[86084]: Disconnected from user root 38.102.83.198 port 52738 Feb 20 19:16:56 np0005625471.novalocal sshd-session[86081]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:56 np0005625471.novalocal systemd-logind[833]: Session 156 logged out. Waiting for processes to exit. Feb 20 19:16:56 np0005625471.novalocal systemd[1]: session-156.scope: Deactivated successfully. Feb 20 19:16:56 np0005625471.novalocal systemd-logind[833]: Removed session 156. Feb 20 19:16:59 np0005625471.novalocal sshd-session[86116]: Accepted publickey for root from 38.102.83.198 port 39934 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:16:59 np0005625471.novalocal systemd-logind[833]: New session 157 of user root. Feb 20 19:16:59 np0005625471.novalocal systemd[1]: Started Session 157 of User root. Feb 20 19:16:59 np0005625471.novalocal sshd-session[86116]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:16:59 np0005625471.novalocal sshd-session[86121]: Received disconnect from 38.102.83.198 port 39934:11: disconnected by user Feb 20 19:16:59 np0005625471.novalocal sshd-session[86121]: Disconnected from user root 38.102.83.198 port 39934 Feb 20 19:16:59 np0005625471.novalocal sshd-session[86116]: pam_unix(sshd:session): session closed for user root Feb 20 19:16:59 np0005625471.novalocal systemd[1]: session-157.scope: Deactivated successfully. Feb 20 19:16:59 np0005625471.novalocal systemd-logind[833]: Session 157 logged out. Waiting for processes to exit. Feb 20 19:16:59 np0005625471.novalocal systemd-logind[833]: Removed session 157. Feb 20 19:17:01 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:17:01 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:17:01 np0005625471.novalocal container-server[83768]: Attempted to replicate 0 dbs in 0.00092 seconds (0.00000/s) Feb 20 19:17:01 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:17:01 np0005625471.novalocal container-server[83768]: 0 successes, 0 failures Feb 20 19:17:01 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:17:02 np0005625471.novalocal sshd-session[86153]: Accepted publickey for root from 38.102.83.198 port 39936 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:02 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:17:02 np0005625471.novalocal systemd-logind[833]: New session 158 of user root. Feb 20 19:17:02 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:17:02 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:17:02 np0005625471.novalocal systemd[1]: Started Session 158 of User root. Feb 20 19:17:02 np0005625471.novalocal sshd-session[86153]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:02 np0005625471.novalocal sshd-session[86157]: Received disconnect from 38.102.83.198 port 39936:11: disconnected by user Feb 20 19:17:02 np0005625471.novalocal sshd-session[86157]: Disconnected from user root 38.102.83.198 port 39936 Feb 20 19:17:02 np0005625471.novalocal sshd-session[86153]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:02 np0005625471.novalocal systemd[1]: session-158.scope: Deactivated successfully. Feb 20 19:17:02 np0005625471.novalocal systemd-logind[833]: Session 158 logged out. Waiting for processes to exit. Feb 20 19:17:02 np0005625471.novalocal systemd-logind[833]: Removed session 158. Feb 20 19:17:03 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:17:03 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:17:03 np0005625471.novalocal account-server[83378]: Attempted to replicate 0 dbs in 0.00045 seconds (0.00000/s) Feb 20 19:17:03 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:17:03 np0005625471.novalocal account-server[83378]: 0 successes, 0 failures Feb 20 19:17:03 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:17:06 np0005625471.novalocal sshd-session[86190]: Accepted publickey for root from 38.102.83.198 port 39946 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:06 np0005625471.novalocal systemd-logind[833]: New session 159 of user root. Feb 20 19:17:06 np0005625471.novalocal systemd[1]: Started Session 159 of User root. Feb 20 19:17:06 np0005625471.novalocal sshd-session[86190]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:06 np0005625471.novalocal sshd-session[86193]: Received disconnect from 38.102.83.198 port 39946:11: disconnected by user Feb 20 19:17:06 np0005625471.novalocal sshd-session[86193]: Disconnected from user root 38.102.83.198 port 39946 Feb 20 19:17:06 np0005625471.novalocal sshd-session[86190]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:06 np0005625471.novalocal systemd[1]: session-159.scope: Deactivated successfully. Feb 20 19:17:06 np0005625471.novalocal systemd-logind[833]: Session 159 logged out. Waiting for processes to exit. Feb 20 19:17:06 np0005625471.novalocal systemd-logind[833]: Removed session 159. Feb 20 19:17:09 np0005625471.novalocal sshd-session[86226]: Accepted publickey for root from 38.102.83.198 port 57956 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:09 np0005625471.novalocal systemd-logind[833]: New session 160 of user root. Feb 20 19:17:09 np0005625471.novalocal systemd[1]: Started Session 160 of User root. Feb 20 19:17:09 np0005625471.novalocal sshd-session[86226]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:09 np0005625471.novalocal sshd-session[86229]: Received disconnect from 38.102.83.198 port 57956:11: disconnected by user Feb 20 19:17:09 np0005625471.novalocal sshd-session[86229]: Disconnected from user root 38.102.83.198 port 57956 Feb 20 19:17:09 np0005625471.novalocal sshd-session[86226]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:09 np0005625471.novalocal systemd[1]: session-160.scope: Deactivated successfully. Feb 20 19:17:09 np0005625471.novalocal systemd-logind[833]: Session 160 logged out. Waiting for processes to exit. Feb 20 19:17:09 np0005625471.novalocal systemd-logind[833]: Removed session 160. Feb 20 19:17:12 np0005625471.novalocal sshd-session[86263]: Accepted publickey for root from 38.102.83.198 port 57958 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:12 np0005625471.novalocal systemd-logind[833]: New session 161 of user root. Feb 20 19:17:12 np0005625471.novalocal systemd[1]: Started Session 161 of User root. Feb 20 19:17:12 np0005625471.novalocal sshd-session[86263]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:12 np0005625471.novalocal sshd-session[86266]: Received disconnect from 38.102.83.198 port 57958:11: disconnected by user Feb 20 19:17:12 np0005625471.novalocal sshd-session[86266]: Disconnected from user root 38.102.83.198 port 57958 Feb 20 19:17:12 np0005625471.novalocal sshd-session[86263]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:12 np0005625471.novalocal systemd[1]: session-161.scope: Deactivated successfully. Feb 20 19:17:12 np0005625471.novalocal systemd-logind[833]: Session 161 logged out. Waiting for processes to exit. Feb 20 19:17:12 np0005625471.novalocal systemd-logind[833]: Removed session 161. Feb 20 19:17:13 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:17:13 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.0004825592041015625 seconds. Feb 20 19:17:13 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:17:14 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:17:15 np0005625471.novalocal systemd-rc-local-generator[86320]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:17:15 np0005625471.novalocal systemd-sysv-generator[86325]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:17:15 np0005625471.novalocal systemd[1]: Started OpenStack Nova NoVNC Proxy Server. Feb 20 19:17:15 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:17:15 np0005625471.novalocal systemd-rc-local-generator[86358]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:17:15 np0005625471.novalocal systemd-sysv-generator[86364]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:17:15 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:17:15 np0005625471.novalocal systemd-sysv-generator[86394]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:17:15 np0005625471.novalocal systemd-rc-local-generator[86391]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:17:15 np0005625471.novalocal sshd-session[86410]: Accepted publickey for root from 38.102.83.198 port 57974 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:15 np0005625471.novalocal systemd-logind[833]: New session 162 of user root. Feb 20 19:17:15 np0005625471.novalocal systemd[1]: Started Session 162 of User root. Feb 20 19:17:15 np0005625471.novalocal sshd-session[86410]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:16 np0005625471.novalocal sshd-session[86416]: Received disconnect from 38.102.83.198 port 57974:11: disconnected by user Feb 20 19:17:16 np0005625471.novalocal sshd-session[86416]: Disconnected from user root 38.102.83.198 port 57974 Feb 20 19:17:16 np0005625471.novalocal sshd-session[86410]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:16 np0005625471.novalocal systemd[1]: session-162.scope: Deactivated successfully. Feb 20 19:17:16 np0005625471.novalocal systemd-logind[833]: Session 162 logged out. Waiting for processes to exit. Feb 20 19:17:16 np0005625471.novalocal systemd-logind[833]: Removed session 162. Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Found no containers directories Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:16 2026 visited - attempted:0 success:0 failure:0 skipped:0 completed:0 Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:16 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:16 2026 created - attempted:0 success:0 failure:0 Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:16 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:16 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:16 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:16 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:17:16 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.00s Feb 20 19:17:17 np0005625471.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Feb 20 19:17:17 np0005625471.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Feb 20 19:17:17 np0005625471.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@2.service. Feb 20 19:17:18 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. For complete SELinux messages run: sealert -l 659035cb-ec48-4cc1-a6f7-6cfd56197bdc Feb 20 19:17:18 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the hostname file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. For complete SELinux messages run: sealert -l 9ec2065b-2e79-47ca-ad9f-e65f74b72f20 Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the rpm file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. For complete SELinux messages run: sealert -l 20b2ceef-1f54-4728-a7ac-b80ba40cc20b Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the gpg file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 805b54a1-d816-4a4f-bb2e-f321977c7d47 Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:19 np0005625471.novalocal sshd-session[86463]: Accepted publickey for root from 38.102.83.198 port 57988 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:19 np0005625471.novalocal systemd-logind[833]: New session 163 of user root. Feb 20 19:17:19 np0005625471.novalocal systemd[1]: Started Session 163 of User root. Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. For complete SELinux messages run: sealert -l fe68a498-23c9-4e96-a83d-bb66253bcfb6 Feb 20 19:17:19 np0005625471.novalocal sshd-session[86463]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the dnf-utils file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. For complete SELinux messages run: sealert -l 84c9ae4d-993d-4ff8-82f3-d9b54716d6bb Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the traceroute file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. For complete SELinux messages run: sealert -l 5b1fb2f0-f477-4f7a-a555-bed194255259 Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the consolehelper file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:19 np0005625471.novalocal sshd-session[86469]: Received disconnect from 38.102.83.198 port 57988:11: disconnected by user Feb 20 19:17:19 np0005625471.novalocal sshd-session[86469]: Disconnected from user root 38.102.83.198 port 57988 Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. For complete SELinux messages run: sealert -l 8e5ab5b0-16ed-47d6-b092-af614087021b Feb 20 19:17:19 np0005625471.novalocal sshd-session[86463]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:19 np0005625471.novalocal systemd[1]: session-163.scope: Deactivated successfully. Feb 20 19:17:19 np0005625471.novalocal systemd-logind[833]: Session 163 logged out. Waiting for processes to exit. Feb 20 19:17:19 np0005625471.novalocal systemd-logind[833]: Removed session 163. Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadb-backup file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. For complete SELinux messages run: sealert -l 41c639f0-0290-4f4b-b6d3-052d02e0e19b Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadbd-safe file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. For complete SELinux messages run: sealert -l 29a523d1-ac85-4a69-b9ee-76365d6a1786 Feb 20 19:17:19 np0005625471.novalocal setroubleshoot[86445]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the keepalived file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:17:22 np0005625471.novalocal sshd-session[86508]: Accepted publickey for root from 38.102.83.198 port 33878 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:22 np0005625471.novalocal systemd-logind[833]: New session 164 of user root. Feb 20 19:17:22 np0005625471.novalocal systemd[1]: Started Session 164 of User root. Feb 20 19:17:22 np0005625471.novalocal sshd-session[86508]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:22 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:17:22 np0005625471.novalocal object-server[84159]: Nothing replicated for 0.0007874965667724609 seconds. Feb 20 19:17:22 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:17:22 np0005625471.novalocal sshd-session[86511]: Received disconnect from 38.102.83.198 port 33878:11: disconnected by user Feb 20 19:17:22 np0005625471.novalocal sshd-session[86511]: Disconnected from user root 38.102.83.198 port 33878 Feb 20 19:17:22 np0005625471.novalocal sshd-session[86508]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:22 np0005625471.novalocal systemd-logind[833]: Session 164 logged out. Waiting for processes to exit. Feb 20 19:17:22 np0005625471.novalocal systemd[1]: session-164.scope: Deactivated successfully. Feb 20 19:17:22 np0005625471.novalocal systemd-logind[833]: Removed session 164. Feb 20 19:17:23 np0005625471.novalocal object-server[86543]: Begin object audit "forever" mode (ALL) Feb 20 19:17:23 np0005625471.novalocal object-server[86543]: Object audit (ALL) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:17:23 np0005625471.novalocal object-server[86542]: Begin object audit "forever" mode (ZBF) Feb 20 19:17:23 np0005625471.novalocal object-server[86542]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:17:25 np0005625471.novalocal sshd-session[86540]: Invalid user n8n from 103.86.198.253 port 38232 Feb 20 19:17:25 np0005625471.novalocal sshd-session[86540]: Received disconnect from 103.86.198.253 port 38232:11: Bye Bye [preauth] Feb 20 19:17:25 np0005625471.novalocal sshd-session[86540]: Disconnected from invalid user n8n 103.86.198.253 port 38232 [preauth] Feb 20 19:17:25 np0005625471.novalocal sshd-session[86548]: Accepted publickey for root from 38.102.83.198 port 33884 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:25 np0005625471.novalocal systemd-logind[833]: New session 165 of user root. Feb 20 19:17:25 np0005625471.novalocal systemd[1]: Started Session 165 of User root. Feb 20 19:17:25 np0005625471.novalocal sshd-session[86548]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:25 np0005625471.novalocal sshd-session[86551]: Received disconnect from 38.102.83.198 port 33884:11: disconnected by user Feb 20 19:17:25 np0005625471.novalocal sshd-session[86551]: Disconnected from user root 38.102.83.198 port 33884 Feb 20 19:17:25 np0005625471.novalocal sshd-session[86548]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:25 np0005625471.novalocal systemd[1]: session-165.scope: Deactivated successfully. Feb 20 19:17:25 np0005625471.novalocal systemd-logind[833]: Session 165 logged out. Waiting for processes to exit. Feb 20 19:17:25 np0005625471.novalocal systemd-logind[833]: Removed session 165. Feb 20 19:17:28 np0005625471.novalocal sshd-session[86583]: Accepted publickey for root from 38.102.83.198 port 33892 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:28 np0005625471.novalocal systemd-logind[833]: New session 166 of user root. Feb 20 19:17:28 np0005625471.novalocal systemd[1]: Started Session 166 of User root. Feb 20 19:17:28 np0005625471.novalocal sshd-session[86583]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:29 np0005625471.novalocal sshd-session[86586]: Received disconnect from 38.102.83.198 port 33892:11: disconnected by user Feb 20 19:17:29 np0005625471.novalocal sshd-session[86586]: Disconnected from user root 38.102.83.198 port 33892 Feb 20 19:17:29 np0005625471.novalocal sshd-session[86583]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:29 np0005625471.novalocal systemd[1]: session-166.scope: Deactivated successfully. Feb 20 19:17:29 np0005625471.novalocal systemd-logind[833]: Session 166 logged out. Waiting for processes to exit. Feb 20 19:17:29 np0005625471.novalocal systemd-logind[833]: Removed session 166. Feb 20 19:17:29 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@2.service: Deactivated successfully. Feb 20 19:17:29 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@2.service: Consumed 1.071s CPU time. Feb 20 19:17:29 np0005625471.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Feb 20 19:17:29 np0005625471.novalocal systemd[1]: setroubleshootd.service: Consumed 1.412s CPU time. Feb 20 19:17:31 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:17:31 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:17:31 np0005625471.novalocal container-server[83768]: Attempted to replicate 0 dbs in 0.00086 seconds (0.00000/s) Feb 20 19:17:31 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:17:31 np0005625471.novalocal container-server[83768]: 0 successes, 0 failures Feb 20 19:17:31 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:17:32 np0005625471.novalocal sshd-session[86657]: Accepted publickey for root from 38.102.83.198 port 44900 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:32 np0005625471.novalocal systemd-logind[833]: New session 167 of user root. Feb 20 19:17:32 np0005625471.novalocal systemd[1]: Started Session 167 of User root. Feb 20 19:17:32 np0005625471.novalocal sshd-session[86657]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:32 np0005625471.novalocal sshd-session[86660]: Received disconnect from 38.102.83.198 port 44900:11: disconnected by user Feb 20 19:17:32 np0005625471.novalocal sshd-session[86660]: Disconnected from user root 38.102.83.198 port 44900 Feb 20 19:17:32 np0005625471.novalocal sshd-session[86657]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:32 np0005625471.novalocal systemd[1]: session-167.scope: Deactivated successfully. Feb 20 19:17:32 np0005625471.novalocal systemd-logind[833]: Session 167 logged out. Waiting for processes to exit. Feb 20 19:17:32 np0005625471.novalocal systemd-logind[833]: Removed session 167. Feb 20 19:17:33 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:17:33 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:17:33 np0005625471.novalocal account-server[83378]: Attempted to replicate 0 dbs in 0.00077 seconds (0.00000/s) Feb 20 19:17:33 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:17:33 np0005625471.novalocal account-server[83378]: 0 successes, 0 failures Feb 20 19:17:33 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:17:35 np0005625471.novalocal sshd-session[86693]: Accepted publickey for root from 38.102.83.198 port 44902 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:35 np0005625471.novalocal systemd-logind[833]: New session 168 of user root. Feb 20 19:17:35 np0005625471.novalocal systemd[1]: Started Session 168 of User root. Feb 20 19:17:35 np0005625471.novalocal sshd-session[86693]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:35 np0005625471.novalocal sshd-session[86696]: Received disconnect from 38.102.83.198 port 44902:11: disconnected by user Feb 20 19:17:35 np0005625471.novalocal sshd-session[86696]: Disconnected from user root 38.102.83.198 port 44902 Feb 20 19:17:35 np0005625471.novalocal sshd-session[86693]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:35 np0005625471.novalocal systemd[1]: session-168.scope: Deactivated successfully. Feb 20 19:17:35 np0005625471.novalocal systemd-logind[833]: Session 168 logged out. Waiting for processes to exit. Feb 20 19:17:35 np0005625471.novalocal systemd-logind[833]: Removed session 168. Feb 20 19:17:38 np0005625471.novalocal sshd-session[86729]: Accepted publickey for root from 38.102.83.198 port 44914 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:38 np0005625471.novalocal systemd-logind[833]: New session 169 of user root. Feb 20 19:17:38 np0005625471.novalocal systemd[1]: Started Session 169 of User root. Feb 20 19:17:38 np0005625471.novalocal sshd-session[86729]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:38 np0005625471.novalocal sshd-session[86732]: Received disconnect from 38.102.83.198 port 44914:11: disconnected by user Feb 20 19:17:38 np0005625471.novalocal sshd-session[86732]: Disconnected from user root 38.102.83.198 port 44914 Feb 20 19:17:38 np0005625471.novalocal sshd-session[86729]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:38 np0005625471.novalocal systemd[1]: session-169.scope: Deactivated successfully. Feb 20 19:17:38 np0005625471.novalocal systemd-logind[833]: Session 169 logged out. Waiting for processes to exit. Feb 20 19:17:38 np0005625471.novalocal systemd-logind[833]: Removed session 169. Feb 20 19:17:41 np0005625471.novalocal sshd-session[86767]: Accepted publickey for root from 38.102.83.198 port 60284 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:41 np0005625471.novalocal systemd-logind[833]: New session 170 of user root. Feb 20 19:17:41 np0005625471.novalocal systemd[1]: Started Session 170 of User root. Feb 20 19:17:41 np0005625471.novalocal sshd-session[86767]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:42 np0005625471.novalocal sshd-session[86770]: Received disconnect from 38.102.83.198 port 60284:11: disconnected by user Feb 20 19:17:42 np0005625471.novalocal sshd-session[86770]: Disconnected from user root 38.102.83.198 port 60284 Feb 20 19:17:42 np0005625471.novalocal sshd-session[86767]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:42 np0005625471.novalocal systemd[1]: session-170.scope: Deactivated successfully. Feb 20 19:17:42 np0005625471.novalocal systemd-logind[833]: Session 170 logged out. Waiting for processes to exit. Feb 20 19:17:42 np0005625471.novalocal systemd-logind[833]: Removed session 170. Feb 20 19:17:43 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:17:43 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.00023794174194335938 seconds. Feb 20 19:17:43 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:17:45 np0005625471.novalocal sshd-session[86802]: Accepted publickey for root from 38.102.83.198 port 60290 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:45 np0005625471.novalocal systemd-logind[833]: New session 171 of user root. Feb 20 19:17:45 np0005625471.novalocal systemd[1]: Started Session 171 of User root. Feb 20 19:17:45 np0005625471.novalocal sshd-session[86802]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:45 np0005625471.novalocal sshd-session[86805]: Received disconnect from 38.102.83.198 port 60290:11: disconnected by user Feb 20 19:17:45 np0005625471.novalocal sshd-session[86805]: Disconnected from user root 38.102.83.198 port 60290 Feb 20 19:17:45 np0005625471.novalocal sshd-session[86802]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:45 np0005625471.novalocal systemd[1]: session-171.scope: Deactivated successfully. Feb 20 19:17:45 np0005625471.novalocal systemd-logind[833]: Session 171 logged out. Waiting for processes to exit. Feb 20 19:17:45 np0005625471.novalocal systemd-logind[833]: Removed session 171. Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Found no containers directories Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:46 2026 visited - attempted:0 success:0 failure:0 skipped:0 completed:0 Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:46 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:46 2026 created - attempted:0 success:0 failure:0 Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:46 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:46 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:46 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:17:46 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:17:46 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.00s Feb 20 19:17:48 np0005625471.novalocal sshd-session[86838]: Accepted publickey for root from 38.102.83.198 port 60296 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:48 np0005625471.novalocal systemd-logind[833]: New session 172 of user root. Feb 20 19:17:48 np0005625471.novalocal systemd[1]: Started Session 172 of User root. Feb 20 19:17:48 np0005625471.novalocal sshd-session[86838]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:48 np0005625471.novalocal sshd-session[86841]: Received disconnect from 38.102.83.198 port 60296:11: disconnected by user Feb 20 19:17:48 np0005625471.novalocal sshd-session[86841]: Disconnected from user root 38.102.83.198 port 60296 Feb 20 19:17:48 np0005625471.novalocal sshd-session[86838]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:48 np0005625471.novalocal systemd[1]: session-172.scope: Deactivated successfully. Feb 20 19:17:48 np0005625471.novalocal systemd-logind[833]: Session 172 logged out. Waiting for processes to exit. Feb 20 19:17:48 np0005625471.novalocal systemd-logind[833]: Removed session 172. Feb 20 19:17:51 np0005625471.novalocal sshd-session[86875]: Accepted publickey for root from 38.102.83.198 port 51846 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:51 np0005625471.novalocal systemd-logind[833]: New session 173 of user root. Feb 20 19:17:51 np0005625471.novalocal systemd[1]: Started Session 173 of User root. Feb 20 19:17:51 np0005625471.novalocal sshd-session[86875]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:51 np0005625471.novalocal sshd-session[86878]: Received disconnect from 38.102.83.198 port 51846:11: disconnected by user Feb 20 19:17:51 np0005625471.novalocal sshd-session[86878]: Disconnected from user root 38.102.83.198 port 51846 Feb 20 19:17:51 np0005625471.novalocal sshd-session[86875]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:51 np0005625471.novalocal systemd[1]: session-173.scope: Deactivated successfully. Feb 20 19:17:51 np0005625471.novalocal systemd-logind[833]: Session 173 logged out. Waiting for processes to exit. Feb 20 19:17:51 np0005625471.novalocal systemd-logind[833]: Removed session 173. Feb 20 19:17:52 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:17:52 np0005625471.novalocal object-server[84159]: Nothing replicated for 0.0005185604095458984 seconds. Feb 20 19:17:52 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:17:53 np0005625471.novalocal object-server[86909]: Begin object audit "forever" mode (ZBF) Feb 20 19:17:53 np0005625471.novalocal object-server[86909]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:17:53 np0005625471.novalocal object-server[86910]: Begin object audit "forever" mode (ALL) Feb 20 19:17:53 np0005625471.novalocal object-server[86910]: Object audit (ALL) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:17:54 np0005625471.novalocal sshd-session[86915]: Accepted publickey for root from 38.102.83.198 port 51858 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:54 np0005625471.novalocal systemd-logind[833]: New session 174 of user root. Feb 20 19:17:54 np0005625471.novalocal systemd[1]: Started Session 174 of User root. Feb 20 19:17:54 np0005625471.novalocal sshd-session[86915]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:55 np0005625471.novalocal sshd-session[86918]: Received disconnect from 38.102.83.198 port 51858:11: disconnected by user Feb 20 19:17:55 np0005625471.novalocal sshd-session[86918]: Disconnected from user root 38.102.83.198 port 51858 Feb 20 19:17:55 np0005625471.novalocal sshd-session[86915]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:55 np0005625471.novalocal systemd[1]: session-174.scope: Deactivated successfully. Feb 20 19:17:55 np0005625471.novalocal systemd-logind[833]: Session 174 logged out. Waiting for processes to exit. Feb 20 19:17:55 np0005625471.novalocal systemd-logind[833]: Removed session 174. Feb 20 19:17:58 np0005625471.novalocal sshd-session[86952]: Accepted publickey for root from 38.102.83.198 port 51862 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:17:58 np0005625471.novalocal systemd-logind[833]: New session 175 of user root. Feb 20 19:17:58 np0005625471.novalocal systemd[1]: Started Session 175 of User root. Feb 20 19:17:58 np0005625471.novalocal sshd-session[86952]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:17:58 np0005625471.novalocal sshd-session[86955]: Received disconnect from 38.102.83.198 port 51862:11: disconnected by user Feb 20 19:17:58 np0005625471.novalocal sshd-session[86955]: Disconnected from user root 38.102.83.198 port 51862 Feb 20 19:17:58 np0005625471.novalocal sshd-session[86952]: pam_unix(sshd:session): session closed for user root Feb 20 19:17:58 np0005625471.novalocal systemd[1]: session-175.scope: Deactivated successfully. Feb 20 19:17:58 np0005625471.novalocal systemd-logind[833]: Session 175 logged out. Waiting for processes to exit. Feb 20 19:17:58 np0005625471.novalocal systemd-logind[833]: Removed session 175. Feb 20 19:18:01 np0005625471.novalocal sshd-session[86990]: Accepted publickey for root from 38.102.83.198 port 41974 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:01 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:18:01 np0005625471.novalocal systemd-logind[833]: New session 176 of user root. Feb 20 19:18:01 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:18:01 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:18:01 np0005625471.novalocal systemd[1]: Started Session 176 of User root. Feb 20 19:18:01 np0005625471.novalocal sshd-session[86990]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:01 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:18:01 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:18:01 np0005625471.novalocal container-server[83768]: Attempted to replicate 0 dbs in 0.00072 seconds (0.00000/s) Feb 20 19:18:01 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:18:01 np0005625471.novalocal container-server[83768]: 0 successes, 0 failures Feb 20 19:18:01 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:18:01 np0005625471.novalocal sshd-session[86994]: Received disconnect from 38.102.83.198 port 41974:11: disconnected by user Feb 20 19:18:01 np0005625471.novalocal sshd-session[86994]: Disconnected from user root 38.102.83.198 port 41974 Feb 20 19:18:01 np0005625471.novalocal sshd-session[86990]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:01 np0005625471.novalocal systemd[1]: session-176.scope: Deactivated successfully. Feb 20 19:18:01 np0005625471.novalocal systemd-logind[833]: Session 176 logged out. Waiting for processes to exit. Feb 20 19:18:01 np0005625471.novalocal systemd-logind[833]: Removed session 176. Feb 20 19:18:03 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:18:03 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:18:03 np0005625471.novalocal account-server[83378]: Attempted to replicate 0 dbs in 0.00070 seconds (0.00000/s) Feb 20 19:18:03 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:18:03 np0005625471.novalocal account-server[83378]: 0 successes, 0 failures Feb 20 19:18:03 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:18:04 np0005625471.novalocal sshd-session[87030]: Accepted publickey for root from 38.102.83.198 port 41984 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:04 np0005625471.novalocal systemd-logind[833]: New session 177 of user root. Feb 20 19:18:04 np0005625471.novalocal systemd[1]: Started Session 177 of User root. Feb 20 19:18:04 np0005625471.novalocal sshd-session[87030]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:04 np0005625471.novalocal sshd-session[87033]: Received disconnect from 38.102.83.198 port 41984:11: disconnected by user Feb 20 19:18:04 np0005625471.novalocal sshd-session[87033]: Disconnected from user root 38.102.83.198 port 41984 Feb 20 19:18:04 np0005625471.novalocal sshd-session[87030]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:04 np0005625471.novalocal systemd[1]: session-177.scope: Deactivated successfully. Feb 20 19:18:04 np0005625471.novalocal systemd-logind[833]: Session 177 logged out. Waiting for processes to exit. Feb 20 19:18:04 np0005625471.novalocal systemd-logind[833]: Removed session 177. Feb 20 19:18:07 np0005625471.novalocal sshd-session[87067]: Accepted publickey for root from 38.102.83.198 port 41994 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:07 np0005625471.novalocal systemd-logind[833]: New session 178 of user root. Feb 20 19:18:07 np0005625471.novalocal systemd[1]: Started Session 178 of User root. Feb 20 19:18:07 np0005625471.novalocal sshd-session[87067]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:08 np0005625471.novalocal sshd-session[87070]: Received disconnect from 38.102.83.198 port 41994:11: disconnected by user Feb 20 19:18:08 np0005625471.novalocal sshd-session[87070]: Disconnected from user root 38.102.83.198 port 41994 Feb 20 19:18:08 np0005625471.novalocal sshd-session[87067]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:08 np0005625471.novalocal systemd[1]: session-178.scope: Deactivated successfully. Feb 20 19:18:08 np0005625471.novalocal systemd-logind[833]: Session 178 logged out. Waiting for processes to exit. Feb 20 19:18:08 np0005625471.novalocal systemd-logind[833]: Removed session 178. Feb 20 19:18:11 np0005625471.novalocal sshd-session[87105]: Accepted publickey for root from 38.102.83.198 port 47650 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:11 np0005625471.novalocal systemd-logind[833]: New session 179 of user root. Feb 20 19:18:11 np0005625471.novalocal systemd[1]: Started Session 179 of User root. Feb 20 19:18:11 np0005625471.novalocal sshd-session[87105]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:11 np0005625471.novalocal sshd-session[87108]: Received disconnect from 38.102.83.198 port 47650:11: disconnected by user Feb 20 19:18:11 np0005625471.novalocal sshd-session[87108]: Disconnected from user root 38.102.83.198 port 47650 Feb 20 19:18:11 np0005625471.novalocal sshd-session[87105]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:11 np0005625471.novalocal systemd-logind[833]: Session 179 logged out. Waiting for processes to exit. Feb 20 19:18:11 np0005625471.novalocal systemd[1]: session-179.scope: Deactivated successfully. Feb 20 19:18:11 np0005625471.novalocal systemd-logind[833]: Removed session 179. Feb 20 19:18:13 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:18:13 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.0004489421844482422 seconds. Feb 20 19:18:13 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:18:14 np0005625471.novalocal sshd-session[87140]: Accepted publickey for root from 38.102.83.198 port 47654 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:14 np0005625471.novalocal systemd-logind[833]: New session 180 of user root. Feb 20 19:18:14 np0005625471.novalocal systemd[1]: Started Session 180 of User root. Feb 20 19:18:14 np0005625471.novalocal sshd-session[87140]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:14 np0005625471.novalocal sshd-session[87143]: Received disconnect from 38.102.83.198 port 47654:11: disconnected by user Feb 20 19:18:14 np0005625471.novalocal sshd-session[87143]: Disconnected from user root 38.102.83.198 port 47654 Feb 20 19:18:14 np0005625471.novalocal sshd-session[87140]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:14 np0005625471.novalocal systemd[1]: session-180.scope: Deactivated successfully. Feb 20 19:18:14 np0005625471.novalocal systemd-logind[833]: Session 180 logged out. Waiting for processes to exit. Feb 20 19:18:14 np0005625471.novalocal systemd-logind[833]: Removed session 180. Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Found no containers directories Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:16 2026 visited - attempted:0 success:0 failure:0 skipped:0 completed:0 Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:16 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:16 2026 created - attempted:0 success:0 failure:0 Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:16 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:16 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:16 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:16 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:18:16 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.00s Feb 20 19:18:17 np0005625471.novalocal sshd-session[87176]: Accepted publickey for root from 38.102.83.198 port 47662 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:17 np0005625471.novalocal systemd-logind[833]: New session 181 of user root. Feb 20 19:18:17 np0005625471.novalocal systemd[1]: Started Session 181 of User root. Feb 20 19:18:17 np0005625471.novalocal sshd-session[87176]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:17 np0005625471.novalocal sshd-session[87179]: Received disconnect from 38.102.83.198 port 47662:11: disconnected by user Feb 20 19:18:17 np0005625471.novalocal sshd-session[87179]: Disconnected from user root 38.102.83.198 port 47662 Feb 20 19:18:17 np0005625471.novalocal sshd-session[87176]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:17 np0005625471.novalocal systemd[1]: session-181.scope: Deactivated successfully. Feb 20 19:18:17 np0005625471.novalocal systemd-logind[833]: Session 181 logged out. Waiting for processes to exit. Feb 20 19:18:17 np0005625471.novalocal systemd-logind[833]: Removed session 181. Feb 20 19:18:20 np0005625471.novalocal sshd-session[87214]: Accepted publickey for root from 38.102.83.198 port 34612 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:20 np0005625471.novalocal systemd-logind[833]: New session 182 of user root. Feb 20 19:18:20 np0005625471.novalocal systemd[1]: Started Session 182 of User root. Feb 20 19:18:20 np0005625471.novalocal sshd-session[87214]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:21 np0005625471.novalocal sshd-session[87217]: Received disconnect from 38.102.83.198 port 34612:11: disconnected by user Feb 20 19:18:21 np0005625471.novalocal sshd-session[87217]: Disconnected from user root 38.102.83.198 port 34612 Feb 20 19:18:21 np0005625471.novalocal sshd-session[87214]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:21 np0005625471.novalocal systemd[1]: session-182.scope: Deactivated successfully. Feb 20 19:18:21 np0005625471.novalocal systemd-logind[833]: Session 182 logged out. Waiting for processes to exit. Feb 20 19:18:21 np0005625471.novalocal systemd-logind[833]: Removed session 182. Feb 20 19:18:22 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:18:22 np0005625471.novalocal object-server[84159]: Nothing replicated for 0.0006914138793945312 seconds. Feb 20 19:18:22 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:18:23 np0005625471.novalocal object-server[86911]: Begin object audit "forever" mode (ZBF) Feb 20 19:18:23 np0005625471.novalocal object-server[86911]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:18:24 np0005625471.novalocal sshd-session[87250]: Accepted publickey for root from 38.102.83.198 port 34614 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:24 np0005625471.novalocal systemd-logind[833]: New session 183 of user root. Feb 20 19:18:24 np0005625471.novalocal systemd[1]: Started Session 183 of User root. Feb 20 19:18:24 np0005625471.novalocal sshd-session[87250]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:24 np0005625471.novalocal sshd-session[87253]: Received disconnect from 38.102.83.198 port 34614:11: disconnected by user Feb 20 19:18:24 np0005625471.novalocal sshd-session[87253]: Disconnected from user root 38.102.83.198 port 34614 Feb 20 19:18:24 np0005625471.novalocal sshd-session[87250]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:24 np0005625471.novalocal systemd-logind[833]: Session 183 logged out. Waiting for processes to exit. Feb 20 19:18:24 np0005625471.novalocal systemd[1]: session-183.scope: Deactivated successfully. Feb 20 19:18:24 np0005625471.novalocal systemd-logind[833]: Removed session 183. Feb 20 19:18:27 np0005625471.novalocal sshd-session[87285]: Accepted publickey for root from 38.102.83.198 port 34622 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:27 np0005625471.novalocal systemd-logind[833]: New session 184 of user root. Feb 20 19:18:27 np0005625471.novalocal systemd[1]: Started Session 184 of User root. Feb 20 19:18:27 np0005625471.novalocal sshd-session[87285]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:27 np0005625471.novalocal sshd-session[87288]: Received disconnect from 38.102.83.198 port 34622:11: disconnected by user Feb 20 19:18:27 np0005625471.novalocal sshd-session[87288]: Disconnected from user root 38.102.83.198 port 34622 Feb 20 19:18:27 np0005625471.novalocal sshd-session[87285]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:27 np0005625471.novalocal systemd[1]: session-184.scope: Deactivated successfully. Feb 20 19:18:27 np0005625471.novalocal systemd-logind[833]: Session 184 logged out. Waiting for processes to exit. Feb 20 19:18:27 np0005625471.novalocal systemd-logind[833]: Removed session 184. Feb 20 19:18:30 np0005625471.novalocal sshd-session[87359]: Accepted publickey for root from 38.102.83.198 port 45582 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:30 np0005625471.novalocal systemd-logind[833]: New session 185 of user root. Feb 20 19:18:30 np0005625471.novalocal systemd[1]: Started Session 185 of User root. Feb 20 19:18:30 np0005625471.novalocal sshd-session[87359]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:30 np0005625471.novalocal sshd-session[87362]: Received disconnect from 38.102.83.198 port 45582:11: disconnected by user Feb 20 19:18:30 np0005625471.novalocal sshd-session[87362]: Disconnected from user root 38.102.83.198 port 45582 Feb 20 19:18:30 np0005625471.novalocal sshd-session[87359]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:30 np0005625471.novalocal systemd[1]: session-185.scope: Deactivated successfully. Feb 20 19:18:30 np0005625471.novalocal systemd-logind[833]: Session 185 logged out. Waiting for processes to exit. Feb 20 19:18:30 np0005625471.novalocal systemd-logind[833]: Removed session 185. Feb 20 19:18:31 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:18:31 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:18:31 np0005625471.novalocal container-server[83768]: Attempted to replicate 0 dbs in 0.00082 seconds (0.00000/s) Feb 20 19:18:31 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:18:31 np0005625471.novalocal container-server[83768]: 0 successes, 0 failures Feb 20 19:18:31 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:18:33 np0005625471.novalocal sshd-session[87394]: Accepted publickey for root from 38.102.83.198 port 45594 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:33 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:18:33 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:18:33 np0005625471.novalocal account-server[83378]: Attempted to replicate 0 dbs in 0.00043 seconds (0.00000/s) Feb 20 19:18:33 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:18:33 np0005625471.novalocal account-server[83378]: 0 successes, 0 failures Feb 20 19:18:33 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:0 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:18:33 np0005625471.novalocal systemd-logind[833]: New session 186 of user root. Feb 20 19:18:33 np0005625471.novalocal systemd[1]: Started Session 186 of User root. Feb 20 19:18:33 np0005625471.novalocal sshd-session[87394]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:34 np0005625471.novalocal sshd-session[87397]: Received disconnect from 38.102.83.198 port 45594:11: disconnected by user Feb 20 19:18:34 np0005625471.novalocal sshd-session[87397]: Disconnected from user root 38.102.83.198 port 45594 Feb 20 19:18:34 np0005625471.novalocal sshd-session[87394]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:34 np0005625471.novalocal systemd[1]: session-186.scope: Deactivated successfully. Feb 20 19:18:34 np0005625471.novalocal systemd-logind[833]: Session 186 logged out. Waiting for processes to exit. Feb 20 19:18:34 np0005625471.novalocal systemd-logind[833]: Removed session 186. Feb 20 19:18:37 np0005625471.novalocal sshd-session[87429]: Accepted publickey for root from 38.102.83.198 port 45608 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:37 np0005625471.novalocal systemd-logind[833]: New session 187 of user root. Feb 20 19:18:37 np0005625471.novalocal systemd[1]: Started Session 187 of User root. Feb 20 19:18:37 np0005625471.novalocal sshd-session[87429]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:37 np0005625471.novalocal sshd-session[87432]: Received disconnect from 38.102.83.198 port 45608:11: disconnected by user Feb 20 19:18:37 np0005625471.novalocal sshd-session[87432]: Disconnected from user root 38.102.83.198 port 45608 Feb 20 19:18:37 np0005625471.novalocal sshd-session[87429]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:37 np0005625471.novalocal systemd[1]: session-187.scope: Deactivated successfully. Feb 20 19:18:37 np0005625471.novalocal systemd-logind[833]: Session 187 logged out. Waiting for processes to exit. Feb 20 19:18:37 np0005625471.novalocal systemd-logind[833]: Removed session 187. Feb 20 19:18:40 np0005625471.novalocal sshd-session[87467]: Accepted publickey for root from 38.102.83.198 port 45532 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:40 np0005625471.novalocal systemd-logind[833]: New session 188 of user root. Feb 20 19:18:40 np0005625471.novalocal systemd[1]: Started Session 188 of User root. Feb 20 19:18:40 np0005625471.novalocal sshd-session[87467]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:40 np0005625471.novalocal sshd-session[87470]: Received disconnect from 38.102.83.198 port 45532:11: disconnected by user Feb 20 19:18:40 np0005625471.novalocal sshd-session[87470]: Disconnected from user root 38.102.83.198 port 45532 Feb 20 19:18:40 np0005625471.novalocal sshd-session[87467]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:40 np0005625471.novalocal systemd[1]: session-188.scope: Deactivated successfully. Feb 20 19:18:40 np0005625471.novalocal systemd-logind[833]: Session 188 logged out. Waiting for processes to exit. Feb 20 19:18:40 np0005625471.novalocal systemd-logind[833]: Removed session 188. Feb 20 19:18:43 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:18:43 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.0003819465637207031 seconds. Feb 20 19:18:43 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:18:43 np0005625471.novalocal sshd-session[87502]: Accepted publickey for root from 38.102.83.198 port 45542 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:43 np0005625471.novalocal systemd-logind[833]: New session 189 of user root. Feb 20 19:18:43 np0005625471.novalocal systemd[1]: Started Session 189 of User root. Feb 20 19:18:43 np0005625471.novalocal sshd-session[87502]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:43 np0005625471.novalocal sshd-session[87505]: Received disconnect from 38.102.83.198 port 45542:11: disconnected by user Feb 20 19:18:43 np0005625471.novalocal sshd-session[87505]: Disconnected from user root 38.102.83.198 port 45542 Feb 20 19:18:43 np0005625471.novalocal sshd-session[87502]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:43 np0005625471.novalocal systemd[1]: session-189.scope: Deactivated successfully. Feb 20 19:18:43 np0005625471.novalocal systemd-logind[833]: Session 189 logged out. Waiting for processes to exit. Feb 20 19:18:43 np0005625471.novalocal systemd-logind[833]: Removed session 189. Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Found no containers directories Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:46 2026 visited - attempted:0 success:0 failure:0 skipped:0 completed:0 Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:46 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:46 2026 created - attempted:0 success:0 failure:0 Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:46 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:46 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:46 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:18:46 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:18:46 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.00s Feb 20 19:18:46 np0005625471.novalocal sshd-session[87538]: Accepted publickey for root from 38.102.83.198 port 45558 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:46 np0005625471.novalocal systemd-logind[833]: New session 190 of user root. Feb 20 19:18:46 np0005625471.novalocal systemd[1]: Started Session 190 of User root. Feb 20 19:18:46 np0005625471.novalocal sshd-session[87538]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:47 np0005625471.novalocal sshd-session[87541]: Received disconnect from 38.102.83.198 port 45558:11: disconnected by user Feb 20 19:18:47 np0005625471.novalocal sshd-session[87541]: Disconnected from user root 38.102.83.198 port 45558 Feb 20 19:18:47 np0005625471.novalocal sshd-session[87538]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:47 np0005625471.novalocal systemd[1]: session-190.scope: Deactivated successfully. Feb 20 19:18:47 np0005625471.novalocal systemd-logind[833]: Session 190 logged out. Waiting for processes to exit. Feb 20 19:18:47 np0005625471.novalocal systemd-logind[833]: Removed session 190. Feb 20 19:18:50 np0005625471.novalocal sshd-session[87575]: Accepted publickey for root from 38.102.83.198 port 54084 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:50 np0005625471.novalocal systemd-logind[833]: New session 191 of user root. Feb 20 19:18:50 np0005625471.novalocal systemd[1]: Started Session 191 of User root. Feb 20 19:18:50 np0005625471.novalocal sshd-session[87575]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:50 np0005625471.novalocal sshd-session[87579]: Received disconnect from 38.102.83.198 port 54084:11: disconnected by user Feb 20 19:18:50 np0005625471.novalocal sshd-session[87579]: Disconnected from user root 38.102.83.198 port 54084 Feb 20 19:18:50 np0005625471.novalocal sshd-session[87575]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:50 np0005625471.novalocal systemd[1]: session-191.scope: Deactivated successfully. Feb 20 19:18:50 np0005625471.novalocal systemd-logind[833]: Session 191 logged out. Waiting for processes to exit. Feb 20 19:18:50 np0005625471.novalocal systemd-logind[833]: Removed session 191. Feb 20 19:18:52 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:18:52 np0005625471.novalocal object-server[84159]: Nothing replicated for 0.0005447864532470703 seconds. Feb 20 19:18:52 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:18:53 np0005625471.novalocal sshd-session[87611]: Accepted publickey for root from 38.102.83.198 port 54090 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:53 np0005625471.novalocal systemd-logind[833]: New session 192 of user root. Feb 20 19:18:53 np0005625471.novalocal systemd[1]: Started Session 192 of User root. Feb 20 19:18:53 np0005625471.novalocal sshd-session[87611]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:53 np0005625471.novalocal sshd-session[87614]: Received disconnect from 38.102.83.198 port 54090:11: disconnected by user Feb 20 19:18:53 np0005625471.novalocal sshd-session[87614]: Disconnected from user root 38.102.83.198 port 54090 Feb 20 19:18:53 np0005625471.novalocal sshd-session[87611]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:53 np0005625471.novalocal systemd[1]: session-192.scope: Deactivated successfully. Feb 20 19:18:53 np0005625471.novalocal systemd-logind[833]: Session 192 logged out. Waiting for processes to exit. Feb 20 19:18:53 np0005625471.novalocal systemd-logind[833]: Removed session 192. Feb 20 19:18:54 np0005625471.novalocal object-server[87644]: Begin object audit "forever" mode (ALL) Feb 20 19:18:54 np0005625471.novalocal object-server[87643]: Begin object audit "forever" mode (ZBF) Feb 20 19:18:54 np0005625471.novalocal object-server[87644]: Object audit (ALL) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:18:54 np0005625471.novalocal object-server[87643]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.00, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:18:56 np0005625471.novalocal sshd-session[87650]: Accepted publickey for root from 38.102.83.198 port 54106 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:56 np0005625471.novalocal systemd-logind[833]: New session 193 of user root. Feb 20 19:18:56 np0005625471.novalocal systemd[1]: Started Session 193 of User root. Feb 20 19:18:56 np0005625471.novalocal sshd-session[87650]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:18:56 np0005625471.novalocal sshd-session[87653]: Received disconnect from 38.102.83.198 port 54106:11: disconnected by user Feb 20 19:18:56 np0005625471.novalocal sshd-session[87653]: Disconnected from user root 38.102.83.198 port 54106 Feb 20 19:18:56 np0005625471.novalocal sshd-session[87650]: pam_unix(sshd:session): session closed for user root Feb 20 19:18:56 np0005625471.novalocal systemd[1]: session-193.scope: Deactivated successfully. Feb 20 19:18:56 np0005625471.novalocal systemd-logind[833]: Session 193 logged out. Waiting for processes to exit. Feb 20 19:18:56 np0005625471.novalocal systemd-logind[833]: Removed session 193. Feb 20 19:18:58 np0005625471.novalocal account-server[83272]: 38.102.83.198 - - [21/Feb/2026:00:18:58 +0000] "HEAD /swiftloopback/229000/AUTH_4e7e2ee118024450a5147ae50b5ffd7e" 404 - "HEAD http://38.102.83.198:8080/v1/AUTH_4e7e2ee118024450a5147ae50b5ffd7e?format=json" "txca864ff30c7b40c590ac6-006998f9f2" "proxy-server 82307" 0.0008 "-" 83272 - Feb 20 19:18:58 np0005625471.novalocal proxy-server[82307]: 38.102.83.198 38.102.83.198 21/Feb/2026/00/18/58 HEAD /v1/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance%3Fformat%3Djson HTTP/1.0 404 - python-swiftclient-4.2.0 gAAAAABpmPnyki9q... - - - txca864ff30c7b40c590ac6-006998f9f2 - 0.5822 - - 1771633138.363630056 1771633138.945851564 - Feb 20 19:18:59 np0005625471.novalocal account-server[83272]: 38.102.83.198 - - [21/Feb/2026:00:18:59 +0000] "PUT /swiftloopback/229000/AUTH_4e7e2ee118024450a5147ae50b5ffd7e" 201 - "-" "txdf552dacb7b14d3bbec22-006998f9f2" "-" 0.3067 "-" 83272 - Feb 20 19:18:59 np0005625471.novalocal proxy-server[82307]: autocreate account '/AUTH_4e7e2ee118024450a5147ae50b5ffd7e' (txn: txdf552dacb7b14d3bbec22-006998f9f2) Feb 20 19:18:59 np0005625471.novalocal account-server[83271]: 38.102.83.198 - - [21/Feb/2026:00:18:59 +0000] "HEAD /swiftloopback/229000/AUTH_4e7e2ee118024450a5147ae50b5ffd7e" 204 - "HEAD http://38.102.83.198:8080/v1/AUTH_4e7e2ee118024450a5147ae50b5ffd7e?format=json" "txdf552dacb7b14d3bbec22-006998f9f2" "proxy-server 82307" 0.0056 "-" 83271 - Feb 20 19:18:59 np0005625471.novalocal account-server[83273]: 38.102.83.198 - - [21/Feb/2026:00:18:59 +0000] "PUT /swiftloopback/229000/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance" 201 - "PUT http://38.102.83.198:6001/swiftloopback/223553/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance" "txdf552dacb7b14d3bbec22-006998f9f2" "container-server 83664" 0.0040 "-" 83273 0 Feb 20 19:18:59 np0005625471.novalocal container-server[83664]: 38.102.83.198 - - [21/Feb/2026:00:18:59 +0000] "PUT /swiftloopback/223553/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance" 201 - "PUT http://38.102.83.198:8080/v1/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance" "txdf552dacb7b14d3bbec22-006998f9f2" "proxy-server 82307" 0.0803 "-" 83664 0 Feb 20 19:18:59 np0005625471.novalocal proxy-server[82307]: 38.102.83.198 38.102.83.198 21/Feb/2026/00/18/59 PUT /v1/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance HTTP/1.0 201 - python-swiftclient-4.2.0 gAAAAABpmPnyki9q... - - - txdf552dacb7b14d3bbec22-006998f9f2 - 0.4129 - - 1771633138.948772907 1771633139.361654520 0 Feb 20 19:18:59 np0005625471.novalocal container-server[83663]: 38.102.83.198 - - [21/Feb/2026:00:18:59 +0000] "HEAD /swiftloopback/223553/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance" 204 - "HEAD http://38.102.83.198:8080/v1/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance?format=json&states=listing" "txcf87be0601cf441bb6d90-006998f9f3" "proxy-server 82307" 0.0052 "-" 83663 0 Feb 20 19:18:59 np0005625471.novalocal sshd-session[87708]: Accepted publickey for root from 38.102.83.198 port 36374 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:18:59 np0005625471.novalocal systemd-logind[833]: New session 194 of user root. Feb 20 19:18:59 np0005625471.novalocal systemd[1]: Started Session 194 of User root. Feb 20 19:18:59 np0005625471.novalocal sshd-session[87708]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:00 np0005625471.novalocal sshd-session[87711]: Received disconnect from 38.102.83.198 port 36374:11: disconnected by user Feb 20 19:19:00 np0005625471.novalocal sshd-session[87711]: Disconnected from user root 38.102.83.198 port 36374 Feb 20 19:19:00 np0005625471.novalocal container-server[83663]: 38.102.83.198 - - [21/Feb/2026:00:19:00 +0000] "PUT /swiftloopback/223553/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance/f342c243-a449-4ea1-a1f1-79ec2a965923" 201 - "PUT http://38.102.83.198:8080/swiftloopback/137698/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance/f342c243-a449-4ea1-a1f1-79ec2a965923" "txcf87be0601cf441bb6d90-006998f9f3" "object-server 84117" 0.0012 "-" 83663 0 Feb 20 19:19:00 np0005625471.novalocal sshd-session[87708]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:00 np0005625471.novalocal object-server[84117]: 38.102.83.198 - - [21/Feb/2026:00:19:00 +0000] "PUT /swiftloopback/137698/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance/f342c243-a449-4ea1-a1f1-79ec2a965923" 201 - "PUT http://38.102.83.198:8080/v1/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance/f342c243-a449-4ea1-a1f1-79ec2a965923" "txcf87be0601cf441bb6d90-006998f9f3" "proxy-server 82307" 0.6767 "-" 84117 0 Feb 20 19:19:00 np0005625471.novalocal systemd[1]: session-194.scope: Deactivated successfully. Feb 20 19:19:00 np0005625471.novalocal proxy-server[82307]: 38.102.83.198 38.102.83.198 21/Feb/2026/00/19/00 PUT /v1/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance/f342c243-a449-4ea1-a1f1-79ec2a965923 HTTP/1.0 201 - python-swiftclient-4.2.0 gAAAAABpmPnyki9q... 21692416 - - txcf87be0601cf441bb6d90-006998f9f3 - 0.6975 - - 1771633139.368507624 1771633140.066040277 0 Feb 20 19:19:00 np0005625471.novalocal systemd-logind[833]: Session 194 logged out. Waiting for processes to exit. Feb 20 19:19:00 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:19:00 np0005625471.novalocal systemd-logind[833]: Removed session 194. Feb 20 19:19:00 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:19:00 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:19:01 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:19:01 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:19:01 np0005625471.novalocal container-server[83768]: Attempted to replicate 1 dbs in 0.29249 seconds (3.41892/s) Feb 20 19:19:01 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:19:01 np0005625471.novalocal container-server[83768]: 1 successes, 0 failures Feb 20 19:19:01 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:19:03 np0005625471.novalocal sshd-session[87769]: Accepted publickey for root from 38.102.83.198 port 36378 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:03 np0005625471.novalocal systemd-logind[833]: New session 195 of user root. Feb 20 19:19:03 np0005625471.novalocal systemd[1]: Started Session 195 of User root. Feb 20 19:19:03 np0005625471.novalocal sshd-session[87769]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:03 np0005625471.novalocal sshd-session[87772]: Received disconnect from 38.102.83.198 port 36378:11: disconnected by user Feb 20 19:19:03 np0005625471.novalocal sshd-session[87772]: Disconnected from user root 38.102.83.198 port 36378 Feb 20 19:19:03 np0005625471.novalocal sshd-session[87769]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:03 np0005625471.novalocal systemd-logind[833]: Session 195 logged out. Waiting for processes to exit. Feb 20 19:19:03 np0005625471.novalocal systemd[1]: session-195.scope: Deactivated successfully. Feb 20 19:19:03 np0005625471.novalocal systemd-logind[833]: Removed session 195. Feb 20 19:19:03 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:19:03 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:19:03 np0005625471.novalocal account-server[83378]: Attempted to replicate 1 dbs in 0.03016 seconds (33.15461/s) Feb 20 19:19:03 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:19:03 np0005625471.novalocal account-server[83378]: 1 successes, 0 failures Feb 20 19:19:03 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:19:06 np0005625471.novalocal sshd-session[87804]: Accepted publickey for root from 38.102.83.198 port 36394 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:06 np0005625471.novalocal systemd-logind[833]: New session 196 of user root. Feb 20 19:19:06 np0005625471.novalocal systemd[1]: Started Session 196 of User root. Feb 20 19:19:06 np0005625471.novalocal sshd-session[87804]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:06 np0005625471.novalocal sshd-session[87807]: Received disconnect from 38.102.83.198 port 36394:11: disconnected by user Feb 20 19:19:06 np0005625471.novalocal sshd-session[87807]: Disconnected from user root 38.102.83.198 port 36394 Feb 20 19:19:06 np0005625471.novalocal sshd-session[87804]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:06 np0005625471.novalocal systemd[1]: session-196.scope: Deactivated successfully. Feb 20 19:19:06 np0005625471.novalocal systemd-logind[833]: Session 196 logged out. Waiting for processes to exit. Feb 20 19:19:06 np0005625471.novalocal systemd-logind[833]: Removed session 196. Feb 20 19:19:09 np0005625471.novalocal sshd-session[87841]: Accepted publickey for root from 38.102.83.198 port 45666 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:09 np0005625471.novalocal systemd-logind[833]: New session 197 of user root. Feb 20 19:19:09 np0005625471.novalocal systemd[1]: Started Session 197 of User root. Feb 20 19:19:09 np0005625471.novalocal sshd-session[87841]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:09 np0005625471.novalocal sshd-session[87845]: Received disconnect from 38.102.83.198 port 45666:11: disconnected by user Feb 20 19:19:09 np0005625471.novalocal sshd-session[87845]: Disconnected from user root 38.102.83.198 port 45666 Feb 20 19:19:09 np0005625471.novalocal sshd-session[87841]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:09 np0005625471.novalocal systemd[1]: session-197.scope: Deactivated successfully. Feb 20 19:19:09 np0005625471.novalocal systemd-logind[833]: Session 197 logged out. Waiting for processes to exit. Feb 20 19:19:09 np0005625471.novalocal systemd-logind[833]: Removed session 197. Feb 20 19:19:12 np0005625471.novalocal sshd-session[87877]: Accepted publickey for root from 38.102.83.198 port 45674 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:12 np0005625471.novalocal systemd-logind[833]: New session 198 of user root. Feb 20 19:19:12 np0005625471.novalocal systemd[1]: Started Session 198 of User root. Feb 20 19:19:12 np0005625471.novalocal sshd-session[87877]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:13 np0005625471.novalocal sshd-session[87880]: Received disconnect from 38.102.83.198 port 45674:11: disconnected by user Feb 20 19:19:13 np0005625471.novalocal sshd-session[87880]: Disconnected from user root 38.102.83.198 port 45674 Feb 20 19:19:13 np0005625471.novalocal sshd-session[87877]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:13 np0005625471.novalocal systemd[1]: session-198.scope: Deactivated successfully. Feb 20 19:19:13 np0005625471.novalocal systemd-logind[833]: Session 198 logged out. Waiting for processes to exit. Feb 20 19:19:13 np0005625471.novalocal systemd-logind[833]: Removed session 198. Feb 20 19:19:13 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:19:13 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.0004153251647949219 seconds. Feb 20 19:19:13 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:19:16 np0005625471.novalocal sshd-session[87912]: Accepted publickey for root from 38.102.83.198 port 45680 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:16 np0005625471.novalocal systemd-logind[833]: New session 199 of user root. Feb 20 19:19:16 np0005625471.novalocal systemd[1]: Started Session 199 of User root. Feb 20 19:19:16 np0005625471.novalocal sshd-session[87912]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:16 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:19:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:16 2026 visited - attempted:0 success:0 failure:0 skipped:1 completed:0 Feb 20 19:19:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:16 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:19:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:16 2026 created - attempted:0 success:0 failure:0 Feb 20 19:19:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:16 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:19:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:16 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:19:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:16 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:19:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:16 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:19:16 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.01s Feb 20 19:19:16 np0005625471.novalocal sshd-session[87916]: Received disconnect from 38.102.83.198 port 45680:11: disconnected by user Feb 20 19:19:16 np0005625471.novalocal sshd-session[87916]: Disconnected from user root 38.102.83.198 port 45680 Feb 20 19:19:16 np0005625471.novalocal sshd-session[87912]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:16 np0005625471.novalocal systemd[1]: session-199.scope: Deactivated successfully. Feb 20 19:19:16 np0005625471.novalocal systemd-logind[833]: Session 199 logged out. Waiting for processes to exit. Feb 20 19:19:16 np0005625471.novalocal systemd-logind[833]: Removed session 199. Feb 20 19:19:19 np0005625471.novalocal sshd-session[87951]: Accepted publickey for root from 38.102.83.198 port 46142 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:19 np0005625471.novalocal systemd-logind[833]: New session 200 of user root. Feb 20 19:19:19 np0005625471.novalocal systemd[1]: Started Session 200 of User root. Feb 20 19:19:19 np0005625471.novalocal sshd-session[87951]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:19 np0005625471.novalocal sshd-session[87954]: Received disconnect from 38.102.83.198 port 46142:11: disconnected by user Feb 20 19:19:19 np0005625471.novalocal sshd-session[87954]: Disconnected from user root 38.102.83.198 port 46142 Feb 20 19:19:19 np0005625471.novalocal sshd-session[87951]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:19 np0005625471.novalocal systemd[1]: session-200.scope: Deactivated successfully. Feb 20 19:19:19 np0005625471.novalocal systemd-logind[833]: Session 200 logged out. Waiting for processes to exit. Feb 20 19:19:19 np0005625471.novalocal systemd-logind[833]: Removed session 200. Feb 20 19:19:22 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:19:22 np0005625471.novalocal object-server[84159]: 1/1 (100.00%) partitions replicated in 0.03s (34.05/sec, 0s remaining) Feb 20 19:19:22 np0005625471.novalocal object-server[84159]: 0 successes, 0 failures Feb 20 19:19:22 np0005625471.novalocal object-server[84159]: 1 suffixes checked - 100.00% hashed, 0.00% synced Feb 20 19:19:22 np0005625471.novalocal object-server[84159]: Partition times: max 0.0289s, min 0.0289s, med 0.0289s Feb 20 19:19:22 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:19:23 np0005625471.novalocal sshd-session[88006]: Accepted publickey for root from 38.102.83.198 port 46152 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:23 np0005625471.novalocal systemd-logind[833]: New session 201 of user root. Feb 20 19:19:23 np0005625471.novalocal systemd[1]: Started Session 201 of User root. Feb 20 19:19:23 np0005625471.novalocal sshd-session[88006]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:23 np0005625471.novalocal sshd-session[88009]: Received disconnect from 38.102.83.198 port 46152:11: disconnected by user Feb 20 19:19:23 np0005625471.novalocal sshd-session[88009]: Disconnected from user root 38.102.83.198 port 46152 Feb 20 19:19:23 np0005625471.novalocal sshd-session[88006]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:23 np0005625471.novalocal systemd-logind[833]: Session 201 logged out. Waiting for processes to exit. Feb 20 19:19:23 np0005625471.novalocal systemd[1]: session-201.scope: Deactivated successfully. Feb 20 19:19:23 np0005625471.novalocal systemd-logind[833]: Removed session 201. Feb 20 19:19:24 np0005625471.novalocal object-server[88039]: Begin object audit "forever" mode (ZBF) Feb 20 19:19:24 np0005625471.novalocal object-server[88040]: Begin object audit "forever" mode (ALL) Feb 20 19:19:24 np0005625471.novalocal object-server[88039]: Object audit (ZBF). Since Sat Feb 21 00:19:24 2026: Locally: 1 passed, 0 quarantined, 0 errors, files/sec: 616.45, bytes/sec: 0.00, Total time: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:19:24 np0005625471.novalocal object-server[88039]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 293.16, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.24 Feb 20 19:19:26 np0005625471.novalocal sshd-session[88047]: Accepted publickey for root from 38.102.83.198 port 46154 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:26 np0005625471.novalocal systemd-logind[833]: New session 202 of user root. Feb 20 19:19:26 np0005625471.novalocal systemd[1]: Started Session 202 of User root. Feb 20 19:19:26 np0005625471.novalocal sshd-session[88047]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:26 np0005625471.novalocal object-server[88040]: Object audit (ALL). Since Sat Feb 21 00:19:24 2026: Locally: 1 passed, 0 quarantined, 0 errors, files/sec: 0.46, bytes/sec: 10019423.05, Total time: 2.17, Auditing time: 0.00, Rate: 0.00 Feb 20 19:19:26 np0005625471.novalocal object-server[88040]: Object audit (ALL) "forever" mode completed: 2.17s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.46, Total bytes/sec: 10009916.69, Auditing time: 2.16, Rate: 1.00 Feb 20 19:19:26 np0005625471.novalocal sshd-session[88050]: Received disconnect from 38.102.83.198 port 46154:11: disconnected by user Feb 20 19:19:26 np0005625471.novalocal sshd-session[88050]: Disconnected from user root 38.102.83.198 port 46154 Feb 20 19:19:26 np0005625471.novalocal sshd-session[88047]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:26 np0005625471.novalocal systemd-logind[833]: Session 202 logged out. Waiting for processes to exit. Feb 20 19:19:26 np0005625471.novalocal systemd[1]: session-202.scope: Deactivated successfully. Feb 20 19:19:26 np0005625471.novalocal systemd-logind[833]: Removed session 202. Feb 20 19:19:29 np0005625471.novalocal sshd-session[88083]: Accepted publickey for root from 38.102.83.198 port 40986 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:29 np0005625471.novalocal systemd-logind[833]: New session 203 of user root. Feb 20 19:19:29 np0005625471.novalocal systemd[1]: Started Session 203 of User root. Feb 20 19:19:29 np0005625471.novalocal sshd-session[88083]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:29 np0005625471.novalocal sshd-session[88088]: Received disconnect from 38.102.83.198 port 40986:11: disconnected by user Feb 20 19:19:29 np0005625471.novalocal sshd-session[88088]: Disconnected from user root 38.102.83.198 port 40986 Feb 20 19:19:29 np0005625471.novalocal sshd-session[88083]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:29 np0005625471.novalocal systemd[1]: session-203.scope: Deactivated successfully. Feb 20 19:19:29 np0005625471.novalocal systemd-logind[833]: Session 203 logged out. Waiting for processes to exit. Feb 20 19:19:29 np0005625471.novalocal systemd-logind[833]: Removed session 203. Feb 20 19:19:30 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:19:31 np0005625471.novalocal systemd-rc-local-generator[88173]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:19:31 np0005625471.novalocal systemd-sysv-generator[88177]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:19:31 np0005625471.novalocal systemd[1]: Starting OpenStack Nova Conductor Server... Feb 20 19:19:31 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:19:31 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:19:31 np0005625471.novalocal container-server[83768]: Attempted to replicate 1 dbs in 0.01441 seconds (69.41176/s) Feb 20 19:19:31 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:19:31 np0005625471.novalocal container-server[83768]: 1 successes, 0 failures Feb 20 19:19:31 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:19:32 np0005625471.novalocal sshd-session[88198]: Accepted publickey for root from 38.102.83.198 port 40990 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:32 np0005625471.novalocal systemd-logind[833]: New session 204 of user root. Feb 20 19:19:32 np0005625471.novalocal systemd[1]: Started Session 204 of User root. Feb 20 19:19:32 np0005625471.novalocal sshd-session[88198]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:32 np0005625471.novalocal sshd-session[88201]: Received disconnect from 38.102.83.198 port 40990:11: disconnected by user Feb 20 19:19:32 np0005625471.novalocal sshd-session[88201]: Disconnected from user root 38.102.83.198 port 40990 Feb 20 19:19:32 np0005625471.novalocal sshd-session[88198]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:32 np0005625471.novalocal systemd-logind[833]: Session 204 logged out. Waiting for processes to exit. Feb 20 19:19:32 np0005625471.novalocal systemd[1]: session-204.scope: Deactivated successfully. Feb 20 19:19:32 np0005625471.novalocal systemd-logind[833]: Removed session 204. Feb 20 19:19:33 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:19:33 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:19:33 np0005625471.novalocal account-server[83378]: Attempted to replicate 1 dbs in 0.00806 seconds (123.99491/s) Feb 20 19:19:33 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:19:33 np0005625471.novalocal account-server[83378]: 1 successes, 0 failures Feb 20 19:19:33 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:19:34 np0005625471.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Feb 20 19:19:34 np0005625471.novalocal systemd[1]: Started OpenStack Nova Conductor Server. Feb 20 19:19:34 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:19:34 np0005625471.novalocal systemd-sysv-generator[88262]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:19:34 np0005625471.novalocal systemd-rc-local-generator[88259]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:19:34 np0005625471.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Feb 20 19:19:34 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:19:34 np0005625471.novalocal systemd-sysv-generator[88297]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:19:34 np0005625471.novalocal systemd-rc-local-generator[88294]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:19:35 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:19:35 np0005625471.novalocal systemd-rc-local-generator[88343]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:19:35 np0005625471.novalocal systemd-sysv-generator[88348]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:19:35 np0005625471.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@3.service. Feb 20 19:19:35 np0005625471.novalocal systemd[1]: Starting OpenStack Nova Scheduler Server... Feb 20 19:19:36 np0005625471.novalocal sshd-session[88369]: Accepted publickey for root from 38.102.83.198 port 40998 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:36 np0005625471.novalocal systemd-logind[833]: New session 205 of user root. Feb 20 19:19:36 np0005625471.novalocal systemd[1]: Started Session 205 of User root. Feb 20 19:19:36 np0005625471.novalocal sshd-session[88369]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:36 np0005625471.novalocal sshd-session[88372]: Received disconnect from 38.102.83.198 port 40998:11: disconnected by user Feb 20 19:19:36 np0005625471.novalocal sshd-session[88372]: Disconnected from user root 38.102.83.198 port 40998 Feb 20 19:19:36 np0005625471.novalocal sshd-session[88369]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:36 np0005625471.novalocal systemd[1]: session-205.scope: Deactivated successfully. Feb 20 19:19:36 np0005625471.novalocal systemd-logind[833]: Session 205 logged out. Waiting for processes to exit. Feb 20 19:19:36 np0005625471.novalocal systemd-logind[833]: Removed session 205. Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. For complete SELinux messages run: sealert -l 659035cb-ec48-4cc1-a6f7-6cfd56197bdc Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the hostname file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. For complete SELinux messages run: sealert -l 9ec2065b-2e79-47ca-ad9f-e65f74b72f20 Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the rpm file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. For complete SELinux messages run: sealert -l 20b2ceef-1f54-4728-a7ac-b80ba40cc20b Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the gpg file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 805b54a1-d816-4a4f-bb2e-f321977c7d47 Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. For complete SELinux messages run: sealert -l fe68a498-23c9-4e96-a83d-bb66253bcfb6 Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the dnf-utils file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. For complete SELinux messages run: sealert -l 84c9ae4d-993d-4ff8-82f3-d9b54716d6bb Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the traceroute file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. For complete SELinux messages run: sealert -l 5b1fb2f0-f477-4f7a-a555-bed194255259 Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the consolehelper file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. For complete SELinux messages run: sealert -l 8e5ab5b0-16ed-47d6-b092-af614087021b Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadb-backup file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. For complete SELinux messages run: sealert -l 41c639f0-0290-4f4b-b6d3-052d02e0e19b Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadbd-safe file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. For complete SELinux messages run: sealert -l 29a523d1-ac85-4a69-b9ee-76365d6a1786 Feb 20 19:19:36 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the keepalived file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. For complete SELinux messages run: sealert -l 659035cb-ec48-4cc1-a6f7-6cfd56197bdc Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/hostname. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the hostname file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. For complete SELinux messages run: sealert -l 9ec2065b-2e79-47ca-ad9f-e65f74b72f20 Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/rpm. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the rpm file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. For complete SELinux messages run: sealert -l 20b2ceef-1f54-4728-a7ac-b80ba40cc20b Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/gpg. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the gpg file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 805b54a1-d816-4a4f-bb2e-f321977c7d47 Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. For complete SELinux messages run: sealert -l fe68a498-23c9-4e96-a83d-bb66253bcfb6 Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/libexec/dnf-utils. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the dnf-utils file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. For complete SELinux messages run: sealert -l 84c9ae4d-993d-4ff8-82f3-d9b54716d6bb Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/traceroute. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the traceroute file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. For complete SELinux messages run: sealert -l 5b1fb2f0-f477-4f7a-a555-bed194255259 Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/consolehelper. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the consolehelper file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. For complete SELinux messages run: sealert -l 8e5ab5b0-16ed-47d6-b092-af614087021b Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadb-backup. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadb-backup file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. For complete SELinux messages run: sealert -l 41c639f0-0290-4f4b-b6d3-052d02e0e19b Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/bin/mariadbd-safe. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the mariadbd-safe file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. For complete SELinux messages run: sealert -l 29a523d1-ac85-4a69-b9ee-76365d6a1786 Feb 20 19:19:37 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /usr/sbin/keepalived. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the keepalived file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'nova-novncproxy' --raw | audit2allow -M my-novanovncproxy # semodule -X 300 -i my-novanovncproxy.pp Feb 20 19:19:38 np0005625471.novalocal systemd[1]: Started OpenStack Nova Scheduler Server. Feb 20 19:19:38 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:19:38 np0005625471.novalocal systemd-rc-local-generator[88440]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:19:38 np0005625471.novalocal systemd-sysv-generator[88444]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:19:38 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:19:38 np0005625471.novalocal systemd-sysv-generator[88482]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:19:38 np0005625471.novalocal systemd-rc-local-generator[88479]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:19:39 np0005625471.novalocal sshd-session[88502]: Accepted publickey for root from 38.102.83.198 port 45718 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:39 np0005625471.novalocal systemd-logind[833]: New session 206 of user root. Feb 20 19:19:39 np0005625471.novalocal systemd[1]: Started Session 206 of User root. Feb 20 19:19:39 np0005625471.novalocal sshd-session[88502]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:39 np0005625471.novalocal sshd-session[88505]: Received disconnect from 38.102.83.198 port 45718:11: disconnected by user Feb 20 19:19:39 np0005625471.novalocal sshd-session[88505]: Disconnected from user root 38.102.83.198 port 45718 Feb 20 19:19:39 np0005625471.novalocal sshd-session[88502]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:39 np0005625471.novalocal systemd[1]: session-206.scope: Deactivated successfully. Feb 20 19:19:39 np0005625471.novalocal systemd-logind[833]: Session 206 logged out. Waiting for processes to exit. Feb 20 19:19:39 np0005625471.novalocal systemd-logind[833]: Removed session 206. Feb 20 19:19:41 np0005625471.novalocal container-server[82588]: Begin container update sweep Feb 20 19:19:41 np0005625471.novalocal account-server[83274]: 38.102.83.198 - - [21/Feb/2026:00:19:41 +0000] "PUT /swiftloopback/229000/AUTH_4e7e2ee118024450a5147ae50b5ffd7e/glance" 201 - "-" "-" "container-updater 82588" 0.0017 "-" 83274 0 Feb 20 19:19:41 np0005625471.novalocal container-server[82588]: Container update sweep completed: 0.11s Feb 20 19:19:42 np0005625471.novalocal sshd-session[88544]: Accepted publickey for root from 38.102.83.198 port 45730 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:42 np0005625471.novalocal systemd-logind[833]: New session 207 of user root. Feb 20 19:19:42 np0005625471.novalocal systemd[1]: Started Session 207 of User root. Feb 20 19:19:42 np0005625471.novalocal sshd-session[88544]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:42 np0005625471.novalocal sshd-session[88547]: Received disconnect from 38.102.83.198 port 45730:11: disconnected by user Feb 20 19:19:42 np0005625471.novalocal sshd-session[88547]: Disconnected from user root 38.102.83.198 port 45730 Feb 20 19:19:42 np0005625471.novalocal sshd-session[88544]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:42 np0005625471.novalocal systemd[1]: session-207.scope: Deactivated successfully. Feb 20 19:19:42 np0005625471.novalocal systemd-logind[833]: Session 207 logged out. Waiting for processes to exit. Feb 20 19:19:42 np0005625471.novalocal systemd-logind[833]: Removed session 207. Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from write access on the directory /var/lib/nova/(null). For complete SELinux messages run: sealert -l b03e6481-1c9c-4bf1-8946-a3ba3d18e8f7 Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from write access on the directory /var/lib/nova/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed write access on the (null) directory by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from add_name access on the directory /var/lib/nova/(null). For complete SELinux messages run: sealert -l fc33a14c-a12b-495e-a337-8ac4e3f69f19 Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from add_name access on the directory /var/lib/nova/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed add_name access on the (null) directory by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from create access on the file /var/lib/nova/(null). For complete SELinux messages run: sealert -l e459fb76-aeb4-4955-9b61-af0fee45dedf Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from create access on the file /var/lib/nova/(null). ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed create access on the (null) file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: failed to retrieve rpm info for path '/var/lib/nova/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13': Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from 'write, open' accesses on the file /var/lib/nova/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. For complete SELinux messages run: sealert -l 6d55dd4e-4496-4a7e-b869-b03a99dbc46f Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from 'write, open' accesses on the file /var/lib/nova/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed write open access on the 3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from getattr access on the file /var/lib/nova/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. For complete SELinux messages run: sealert -l c9a8d9c1-ac10-4609-aa0c-7681fc043051 Feb 20 19:19:43 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from getattr access on the file /var/lib/nova/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed getattr access on the 3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:19:43 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:19:43 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.00019097328186035156 seconds. Feb 20 19:19:43 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:19:44 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from ioctl access on the file /var/lib/nova/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. For complete SELinux messages run: sealert -l b9ec4566-8667-452a-b12c-4b46541045a0 Feb 20 19:19:44 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from ioctl access on the file /var/lib/nova/.cache/python-entrypoints/3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed ioctl access on the 3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:19:45 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from read access on the file 3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. For complete SELinux messages run: sealert -l 9f96c354-e07a-4a77-a851-58f3e31dea98 Feb 20 19:19:45 np0005625471.novalocal setroubleshoot[88232]: SELinux is preventing /usr/sbin/httpd from read access on the file 3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that httpd should be allowed read access on the 3b31230c9bb179ce7d9c1946a4bc6b973d4b5a00eb62c93020594b6b29a0ab13 file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'httpd' --raw | audit2allow -M my-httpd # semodule -X 300 -i my-httpd.pp Feb 20 19:19:45 np0005625471.novalocal sshd-session[88587]: Accepted publickey for root from 38.102.83.198 port 45732 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:45 np0005625471.novalocal systemd-logind[833]: New session 208 of user root. Feb 20 19:19:45 np0005625471.novalocal systemd[1]: Started Session 208 of User root. Feb 20 19:19:45 np0005625471.novalocal sshd-session[88587]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:45 np0005625471.novalocal sshd-session[88590]: Received disconnect from 38.102.83.198 port 45732:11: disconnected by user Feb 20 19:19:45 np0005625471.novalocal sshd-session[88590]: Disconnected from user root 38.102.83.198 port 45732 Feb 20 19:19:45 np0005625471.novalocal sshd-session[88587]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:45 np0005625471.novalocal systemd[1]: session-208.scope: Deactivated successfully. Feb 20 19:19:45 np0005625471.novalocal systemd-logind[833]: Session 208 logged out. Waiting for processes to exit. Feb 20 19:19:45 np0005625471.novalocal systemd-logind[833]: Removed session 208. Feb 20 19:19:46 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:19:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:46 2026 visited - attempted:0 success:0 failure:0 skipped:1 completed:0 Feb 20 19:19:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:46 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:19:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:46 2026 created - attempted:0 success:0 failure:0 Feb 20 19:19:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:46 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:19:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:46 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:19:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:46 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:19:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:19:46 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:19:46 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.01s Feb 20 19:19:49 np0005625471.novalocal sshd-session[88627]: Accepted publickey for root from 38.102.83.198 port 45738 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:49 np0005625471.novalocal systemd-logind[833]: New session 209 of user root. Feb 20 19:19:49 np0005625471.novalocal systemd[1]: Started Session 209 of User root. Feb 20 19:19:49 np0005625471.novalocal sshd-session[88627]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:49 np0005625471.novalocal sshd-session[88630]: Received disconnect from 38.102.83.198 port 45738:11: disconnected by user Feb 20 19:19:49 np0005625471.novalocal sshd-session[88630]: Disconnected from user root 38.102.83.198 port 45738 Feb 20 19:19:49 np0005625471.novalocal sshd-session[88627]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:49 np0005625471.novalocal systemd[1]: session-209.scope: Deactivated successfully. Feb 20 19:19:49 np0005625471.novalocal systemd-logind[833]: Session 209 logged out. Waiting for processes to exit. Feb 20 19:19:49 np0005625471.novalocal systemd-logind[833]: Removed session 209. Feb 20 19:19:52 np0005625471.novalocal sshd-session[88668]: Accepted publickey for root from 38.102.83.198 port 33372 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:52 np0005625471.novalocal systemd-logind[833]: New session 210 of user root. Feb 20 19:19:52 np0005625471.novalocal systemd[1]: Started Session 210 of User root. Feb 20 19:19:52 np0005625471.novalocal sshd-session[88668]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:52 np0005625471.novalocal sshd-session[88671]: Received disconnect from 38.102.83.198 port 33372:11: disconnected by user Feb 20 19:19:52 np0005625471.novalocal sshd-session[88671]: Disconnected from user root 38.102.83.198 port 33372 Feb 20 19:19:52 np0005625471.novalocal sshd-session[88668]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:52 np0005625471.novalocal systemd[1]: session-210.scope: Deactivated successfully. Feb 20 19:19:52 np0005625471.novalocal systemd-logind[833]: Session 210 logged out. Waiting for processes to exit. Feb 20 19:19:52 np0005625471.novalocal systemd-logind[833]: Removed session 210. Feb 20 19:19:52 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:19:52 np0005625471.novalocal object-server[84159]: 1/1 (100.00%) partitions replicated in 0.00s (400.45/sec, 0s remaining) Feb 20 19:19:52 np0005625471.novalocal object-server[84159]: 0 successes, 0 failures Feb 20 19:19:52 np0005625471.novalocal object-server[84159]: 1 suffixes checked - 0.00% hashed, 0.00% synced Feb 20 19:19:52 np0005625471.novalocal object-server[84159]: Partition times: max 0.0016s, min 0.0016s, med 0.0016s Feb 20 19:19:52 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:19:54 np0005625471.novalocal object-server[88041]: Begin object audit "forever" mode (ZBF) Feb 20 19:19:54 np0005625471.novalocal object-server[88041]: Object audit (ZBF). Since Sat Feb 21 00:19:54 2026: Locally: 1 passed, 0 quarantined, 0 errors, files/sec: 1023.00, bytes/sec: 0.00, Total time: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:19:54 np0005625471.novalocal object-server[88041]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 519.48, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.23 Feb 20 19:19:55 np0005625471.novalocal sshd-session[88704]: Accepted publickey for root from 38.102.83.198 port 33382 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:55 np0005625471.novalocal systemd-logind[833]: New session 211 of user root. Feb 20 19:19:55 np0005625471.novalocal systemd[1]: Started Session 211 of User root. Feb 20 19:19:55 np0005625471.novalocal sshd-session[88704]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:55 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@3.service: Deactivated successfully. Feb 20 19:19:55 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@3.service: Consumed 1.064s CPU time. Feb 20 19:19:55 np0005625471.novalocal sshd-session[88707]: Received disconnect from 38.102.83.198 port 33382:11: disconnected by user Feb 20 19:19:55 np0005625471.novalocal sshd-session[88707]: Disconnected from user root 38.102.83.198 port 33382 Feb 20 19:19:55 np0005625471.novalocal sshd-session[88704]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:55 np0005625471.novalocal systemd-logind[833]: Session 211 logged out. Waiting for processes to exit. Feb 20 19:19:55 np0005625471.novalocal systemd[1]: session-211.scope: Deactivated successfully. Feb 20 19:19:55 np0005625471.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Feb 20 19:19:55 np0005625471.novalocal systemd[1]: setroubleshootd.service: Consumed 1.950s CPU time. Feb 20 19:19:55 np0005625471.novalocal systemd-logind[833]: Removed session 211. Feb 20 19:19:58 np0005625471.novalocal sshd-session[88740]: Accepted publickey for root from 38.102.83.198 port 33398 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:19:58 np0005625471.novalocal systemd-logind[833]: New session 212 of user root. Feb 20 19:19:58 np0005625471.novalocal systemd[1]: Started Session 212 of User root. Feb 20 19:19:58 np0005625471.novalocal sshd-session[88740]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:19:58 np0005625471.novalocal sshd-session[88743]: Received disconnect from 38.102.83.198 port 33398:11: disconnected by user Feb 20 19:19:58 np0005625471.novalocal sshd-session[88743]: Disconnected from user root 38.102.83.198 port 33398 Feb 20 19:19:58 np0005625471.novalocal sshd-session[88740]: pam_unix(sshd:session): session closed for user root Feb 20 19:19:58 np0005625471.novalocal systemd[1]: session-212.scope: Deactivated successfully. Feb 20 19:19:58 np0005625471.novalocal systemd-logind[833]: Session 212 logged out. Waiting for processes to exit. Feb 20 19:19:58 np0005625471.novalocal systemd-logind[833]: Removed session 212. Feb 20 19:20:00 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:20:00 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:20:00 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:20:00 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:00 np0005625471.novalocal systemd-rc-local-generator[88796]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:00 np0005625471.novalocal systemd-sysv-generator[88802]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:01 np0005625471.novalocal systemd[1]: Started OpenStack Trove API Service. Feb 20 19:20:01 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:01 np0005625471.novalocal systemd-sysv-generator[88837]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:01 np0005625471.novalocal systemd-rc-local-generator[88832]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:01 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:01 np0005625471.novalocal systemd-rc-local-generator[88874]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:01 np0005625471.novalocal systemd-sysv-generator[88877]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:01 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:20:01 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:20:01 np0005625471.novalocal container-server[83768]: Attempted to replicate 1 dbs in 0.02203 seconds (45.38533/s) Feb 20 19:20:01 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:20:01 np0005625471.novalocal container-server[83768]: 1 successes, 0 failures Feb 20 19:20:01 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:20:01 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:01 np0005625471.novalocal systemd-sysv-generator[88914]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:01 np0005625471.novalocal systemd-rc-local-generator[88909]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:02 np0005625471.novalocal sshd-session[88931]: Accepted publickey for root from 38.102.83.198 port 47722 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:02 np0005625471.novalocal systemd[1]: Started OpenStack Trove Conductor Service. Feb 20 19:20:02 np0005625471.novalocal systemd-logind[833]: New session 213 of user root. Feb 20 19:20:02 np0005625471.novalocal systemd[1]: Started Session 213 of User root. Feb 20 19:20:02 np0005625471.novalocal sshd-session[88931]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:02 np0005625471.novalocal trove-api[88814]: /usr/lib/python3.9/site-packages/oslo_db/sqlalchemy/enginefacade.py:373: NotSupportedWarning: Configuration option(s) ['idle_timeout'] not supported Feb 20 19:20:02 np0005625471.novalocal trove-api[88814]: warnings.warn( Feb 20 19:20:02 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:02 np0005625471.novalocal sshd-session[88936]: Received disconnect from 38.102.83.198 port 47722:11: disconnected by user Feb 20 19:20:02 np0005625471.novalocal sshd-session[88936]: Disconnected from user root 38.102.83.198 port 47722 Feb 20 19:20:02 np0005625471.novalocal sshd-session[88931]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:02 np0005625471.novalocal systemd-sysv-generator[88987]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:02 np0005625471.novalocal systemd-rc-local-generator[88983]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:02 np0005625471.novalocal systemd[1]: session-213.scope: Deactivated successfully. Feb 20 19:20:02 np0005625471.novalocal systemd-logind[833]: Session 213 logged out. Waiting for processes to exit. Feb 20 19:20:02 np0005625471.novalocal systemd-logind[833]: Removed session 213. Feb 20 19:20:02 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:02 np0005625471.novalocal systemd-rc-local-generator[89022]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:02 np0005625471.novalocal systemd-sysv-generator[89025]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:02 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:03 np0005625471.novalocal systemd-rc-local-generator[89065]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:03 np0005625471.novalocal systemd-sysv-generator[89070]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:03 np0005625471.novalocal trove-conductor[88934]: /usr/lib/python3.9/site-packages/oslo_db/sqlalchemy/enginefacade.py:373: NotSupportedWarning: Configuration option(s) ['idle_timeout'] not supported Feb 20 19:20:03 np0005625471.novalocal trove-conductor[88934]: warnings.warn( Feb 20 19:20:03 np0005625471.novalocal systemd[1]: Started OpenStack Trove taskmanager service. Feb 20 19:20:03 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:03 np0005625471.novalocal systemd-rc-local-generator[89107]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:03 np0005625471.novalocal systemd-sysv-generator[89110]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:03 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:03 np0005625471.novalocal systemd-rc-local-generator[89146]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:03 np0005625471.novalocal systemd-sysv-generator[89150]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:03 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:20:03 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:20:03 np0005625471.novalocal account-server[83378]: Attempted to replicate 1 dbs in 0.02297 seconds (43.53403/s) Feb 20 19:20:03 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:20:03 np0005625471.novalocal account-server[83378]: 1 successes, 0 failures Feb 20 19:20:03 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:20:04 np0005625471.novalocal trove-taskmanager[89086]: /usr/lib/python3.9/site-packages/oslo_db/sqlalchemy/enginefacade.py:373: NotSupportedWarning: Configuration option(s) ['idle_timeout'] not supported Feb 20 19:20:04 np0005625471.novalocal trove-taskmanager[89086]: warnings.warn( Feb 20 19:20:05 np0005625471.novalocal sshd-session[89167]: Accepted publickey for root from 38.102.83.198 port 47738 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:05 np0005625471.novalocal systemd-logind[833]: New session 214 of user root. Feb 20 19:20:05 np0005625471.novalocal systemd[1]: Started Session 214 of User root. Feb 20 19:20:05 np0005625471.novalocal sshd-session[89167]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:05 np0005625471.novalocal sshd-session[89170]: Received disconnect from 38.102.83.198 port 47738:11: disconnected by user Feb 20 19:20:05 np0005625471.novalocal sshd-session[89170]: Disconnected from user root 38.102.83.198 port 47738 Feb 20 19:20:05 np0005625471.novalocal sshd-session[89167]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:05 np0005625471.novalocal systemd-logind[833]: Session 214 logged out. Waiting for processes to exit. Feb 20 19:20:05 np0005625471.novalocal systemd[1]: session-214.scope: Deactivated successfully. Feb 20 19:20:05 np0005625471.novalocal systemd-logind[833]: Removed session 214. Feb 20 19:20:06 np0005625471.novalocal object-server[82985]: Begin object update sweep Feb 20 19:20:06 np0005625471.novalocal object-server[89198]: Object update sweep starting on /srv/node/swiftloopback (pid: 89198) Feb 20 19:20:06 np0005625471.novalocal object-server[89198]: Object update sweep completed on /srv/node/swiftloopback in 0.00s seconds:, 0 successes, 0 failures, 0 quarantines, 0 unlinks, 0 errors, 0 redirects, 0 skips, 0 deferrals, 0 drains (pid: 89198) Feb 20 19:20:06 np0005625471.novalocal object-server[89198]: Object update sweep of swiftloopback completed: 0.00s, 0 successes, 0 failures, 0 quarantines, 0 unlinks, 0 errors, 0 redirects, 0 skips, 0 deferrals, 0 drains Feb 20 19:20:06 np0005625471.novalocal object-server[82985]: Object update sweep completed: 0.12s Feb 20 19:20:06 np0005625471.novalocal account-server[83273]: 38.102.83.198 - - [21/Feb/2026:00:20:06 +0000] "HEAD /swiftloopback/104798/.expiring_objects" 404 - "HEAD http://localhost/v1/.expiring_objects?format=json" "txd926e797281542c5ba384-006998fa36" "Swift Object Expirer" 0.0009 "-" 83273 - Feb 20 19:20:06 np0005625471.novalocal object-expirer-ic[82309]: - - 21/Feb/2026/00/20/06 HEAD /v1/.expiring_objects%3Fformat%3Djson HTTP/1.0 404 - Swift%20Object%20Expirer - - - - txd926e797281542c5ba384-006998fa36 - 0.0076 - - 1771633206.623240471 1771633206.630850077 - Feb 20 19:20:06 np0005625471.novalocal object-expirer[82309]: Pass completed in 0s; 0 objects expired Feb 20 19:20:08 np0005625471.novalocal sshd-session[89202]: Accepted publickey for root from 38.102.83.198 port 47742 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:08 np0005625471.novalocal systemd-logind[833]: New session 215 of user root. Feb 20 19:20:08 np0005625471.novalocal systemd[1]: Started Session 215 of User root. Feb 20 19:20:08 np0005625471.novalocal sshd-session[89202]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:08 np0005625471.novalocal sshd-session[89205]: Received disconnect from 38.102.83.198 port 47742:11: disconnected by user Feb 20 19:20:08 np0005625471.novalocal sshd-session[89205]: Disconnected from user root 38.102.83.198 port 47742 Feb 20 19:20:08 np0005625471.novalocal sshd-session[89202]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:08 np0005625471.novalocal systemd[1]: session-215.scope: Deactivated successfully. Feb 20 19:20:08 np0005625471.novalocal systemd-logind[833]: Session 215 logged out. Waiting for processes to exit. Feb 20 19:20:08 np0005625471.novalocal systemd-logind[833]: Removed session 215. Feb 20 19:20:11 np0005625471.novalocal sshd-session[89238]: Accepted publickey for root from 38.102.83.198 port 47122 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:11 np0005625471.novalocal systemd-logind[833]: New session 216 of user root. Feb 20 19:20:11 np0005625471.novalocal systemd[1]: Started Session 216 of User root. Feb 20 19:20:11 np0005625471.novalocal sshd-session[89238]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:12 np0005625471.novalocal sshd-session[89241]: Received disconnect from 38.102.83.198 port 47122:11: disconnected by user Feb 20 19:20:12 np0005625471.novalocal sshd-session[89241]: Disconnected from user root 38.102.83.198 port 47122 Feb 20 19:20:12 np0005625471.novalocal sshd-session[89238]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:12 np0005625471.novalocal systemd-logind[833]: Session 216 logged out. Waiting for processes to exit. Feb 20 19:20:12 np0005625471.novalocal systemd[1]: session-216.scope: Deactivated successfully. Feb 20 19:20:12 np0005625471.novalocal systemd-logind[833]: Removed session 216. Feb 20 19:20:13 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:20:13 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.0003199577331542969 seconds. Feb 20 19:20:13 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:20:15 np0005625471.novalocal sshd-session[89272]: Accepted publickey for root from 38.102.83.198 port 47134 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:15 np0005625471.novalocal systemd-logind[833]: New session 217 of user root. Feb 20 19:20:15 np0005625471.novalocal systemd[1]: Started Session 217 of User root. Feb 20 19:20:15 np0005625471.novalocal sshd-session[89272]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:15 np0005625471.novalocal sshd-session[89275]: Received disconnect from 38.102.83.198 port 47134:11: disconnected by user Feb 20 19:20:15 np0005625471.novalocal sshd-session[89275]: Disconnected from user root 38.102.83.198 port 47134 Feb 20 19:20:15 np0005625471.novalocal sshd-session[89272]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:15 np0005625471.novalocal systemd[1]: session-217.scope: Deactivated successfully. Feb 20 19:20:15 np0005625471.novalocal systemd-logind[833]: Session 217 logged out. Waiting for processes to exit. Feb 20 19:20:15 np0005625471.novalocal systemd-logind[833]: Removed session 217. Feb 20 19:20:16 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:20:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:16 2026 visited - attempted:0 success:0 failure:0 skipped:1 completed:0 Feb 20 19:20:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:16 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:20:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:16 2026 created - attempted:0 success:0 failure:0 Feb 20 19:20:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:16 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:20:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:16 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:20:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:16 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:20:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:16 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:20:16 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.01s Feb 20 19:20:17 np0005625471.novalocal systemd[1]: session-19.scope: Deactivated successfully. Feb 20 19:20:17 np0005625471.novalocal systemd[1]: session-19.scope: Consumed 7min 12.934s CPU time. Feb 20 19:20:17 np0005625471.novalocal systemd-logind[833]: Removed session 19. Feb 20 19:20:18 np0005625471.novalocal sshd-session[89307]: Accepted publickey for root from 38.102.83.198 port 47136 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:18 np0005625471.novalocal systemd-logind[833]: New session 218 of user root. Feb 20 19:20:18 np0005625471.novalocal systemd[1]: Started Session 218 of User root. Feb 20 19:20:18 np0005625471.novalocal sshd-session[89307]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:18 np0005625471.novalocal sshd-session[89310]: Received disconnect from 38.102.83.198 port 47136:11: disconnected by user Feb 20 19:20:18 np0005625471.novalocal sshd-session[89310]: Disconnected from user root 38.102.83.198 port 47136 Feb 20 19:20:18 np0005625471.novalocal sshd-session[89307]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:18 np0005625471.novalocal systemd[1]: session-218.scope: Deactivated successfully. Feb 20 19:20:18 np0005625471.novalocal systemd-logind[833]: Session 218 logged out. Waiting for processes to exit. Feb 20 19:20:18 np0005625471.novalocal systemd-logind[833]: Removed session 218. Feb 20 19:20:19 np0005625471.novalocal sshd-session[89341]: Accepted publickey for root from 38.102.83.198 port 34972 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:19 np0005625471.novalocal systemd-logind[833]: New session 219 of user root. Feb 20 19:20:19 np0005625471.novalocal systemd[1]: Started Session 219 of User root. Feb 20 19:20:19 np0005625471.novalocal sshd-session[89341]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:19 np0005625471.novalocal sshd-session[89344]: Received disconnect from 38.102.83.198 port 34972:11: disconnected by user Feb 20 19:20:19 np0005625471.novalocal sshd-session[89344]: Disconnected from user root 38.102.83.198 port 34972 Feb 20 19:20:19 np0005625471.novalocal sshd-session[89341]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:20 np0005625471.novalocal systemd-logind[833]: Session 219 logged out. Waiting for processes to exit. Feb 20 19:20:20 np0005625471.novalocal sshd-session[89380]: Accepted publickey for root from 38.102.83.198 port 34982 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:20 np0005625471.novalocal systemd-logind[833]: New session 220 of user root. Feb 20 19:20:20 np0005625471.novalocal systemd[1]: Started Session 220 of User root. Feb 20 19:20:20 np0005625471.novalocal sshd-session[89380]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:20 np0005625471.novalocal sshd-session[89383]: Received disconnect from 38.102.83.198 port 34982:11: disconnected by user Feb 20 19:20:20 np0005625471.novalocal sshd-session[89383]: Disconnected from user root 38.102.83.198 port 34982 Feb 20 19:20:20 np0005625471.novalocal sshd-session[89380]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:20 np0005625471.novalocal systemd[1]: session-220.scope: Deactivated successfully. Feb 20 19:20:20 np0005625471.novalocal systemd-logind[833]: Session 220 logged out. Waiting for processes to exit. Feb 20 19:20:20 np0005625471.novalocal systemd-logind[833]: Removed session 220. Feb 20 19:20:22 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:20:22 np0005625471.novalocal object-server[84159]: 1/1 (100.00%) partitions replicated in 0.00s (336.14/sec, 0s remaining) Feb 20 19:20:22 np0005625471.novalocal object-server[84159]: 0 successes, 0 failures Feb 20 19:20:22 np0005625471.novalocal object-server[84159]: 1 suffixes checked - 0.00% hashed, 0.00% synced Feb 20 19:20:22 np0005625471.novalocal object-server[84159]: Partition times: max 0.0018s, min 0.0018s, med 0.0018s Feb 20 19:20:22 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:20:23 np0005625471.novalocal sshd-session[89492]: Accepted publickey for root from 38.102.83.198 port 34986 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:23 np0005625471.novalocal systemd-logind[833]: New session 221 of user root. Feb 20 19:20:23 np0005625471.novalocal systemd[1]: Started Session 221 of User root. Feb 20 19:20:23 np0005625471.novalocal sshd-session[89492]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:23 np0005625471.novalocal sshd-session[89497]: Received disconnect from 38.102.83.198 port 34986:11: disconnected by user Feb 20 19:20:23 np0005625471.novalocal sshd-session[89497]: Disconnected from user root 38.102.83.198 port 34986 Feb 20 19:20:23 np0005625471.novalocal sshd-session[89492]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:23 np0005625471.novalocal systemd[1]: session-221.scope: Deactivated successfully. Feb 20 19:20:23 np0005625471.novalocal systemd-logind[833]: Session 221 logged out. Waiting for processes to exit. Feb 20 19:20:23 np0005625471.novalocal systemd-logind[833]: Removed session 221. Feb 20 19:20:24 np0005625471.novalocal object-server[89546]: Begin object audit "forever" mode (ZBF) Feb 20 19:20:24 np0005625471.novalocal object-server[89546]: Object audit (ZBF). Since Sat Feb 21 00:20:24 2026: Locally: 1 passed, 0 quarantined, 0 errors, files/sec: 644.48, bytes/sec: 0.00, Total time: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:20:24 np0005625471.novalocal object-server[89546]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 337.84, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.24 Feb 20 19:20:24 np0005625471.novalocal object-server[89547]: Begin object audit "forever" mode (ALL) Feb 20 19:20:26 np0005625471.novalocal object-server[89547]: Object audit (ALL). Since Sat Feb 21 00:20:24 2026: Locally: 1 passed, 0 quarantined, 0 errors, files/sec: 0.46, bytes/sec: 10017788.13, Total time: 2.17, Auditing time: 0.00, Rate: 0.00 Feb 20 19:20:26 np0005625471.novalocal object-server[89547]: Object audit (ALL) "forever" mode completed: 2.17s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.46, Total bytes/sec: 10007187.39, Auditing time: 2.16, Rate: 1.00 Feb 20 19:20:26 np0005625471.novalocal sshd-session[89560]: Accepted publickey for root from 38.102.83.198 port 35000 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:26 np0005625471.novalocal systemd-logind[833]: New session 222 of user root. Feb 20 19:20:26 np0005625471.novalocal systemd[1]: Started Session 222 of User root. Feb 20 19:20:26 np0005625471.novalocal sshd-session[89560]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:26 np0005625471.novalocal sshd-session[89563]: Received disconnect from 38.102.83.198 port 35000:11: disconnected by user Feb 20 19:20:26 np0005625471.novalocal sshd-session[89563]: Disconnected from user root 38.102.83.198 port 35000 Feb 20 19:20:26 np0005625471.novalocal sshd-session[89560]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:26 np0005625471.novalocal systemd[1]: session-222.scope: Deactivated successfully. Feb 20 19:20:26 np0005625471.novalocal systemd-logind[833]: Session 222 logged out. Waiting for processes to exit. Feb 20 19:20:26 np0005625471.novalocal systemd-logind[833]: Removed session 222. Feb 20 19:20:27 np0005625471.novalocal systemd[1]: run-netns-testns\x2d515493493.mount: Deactivated successfully. Feb 20 19:20:28 np0005625471.novalocal systemd[1]: run-netns-testns\x2d627959296.mount: Deactivated successfully. Feb 20 19:20:28 np0005625471.novalocal systemd[1]: run-netns-testns\x2d1249470989.mount: Deactivated successfully. Feb 20 19:20:28 np0005625471.novalocal runuser[89656]: pam_unix(runuser:session): session opened for user rabbitmq(uid=979) by root(uid=0) Feb 20 19:20:29 np0005625471.novalocal runuser[89656]: pam_unix(runuser:session): session closed for user rabbitmq Feb 20 19:20:29 np0005625471.novalocal runuser[89709]: pam_unix(runuser:session): session opened for user rabbitmq(uid=979) by root(uid=0) Feb 20 19:20:29 np0005625471.novalocal runuser[89709]: pam_unix(runuser:session): session closed for user rabbitmq Feb 20 19:20:29 np0005625471.novalocal runuser[89765]: pam_unix(runuser:session): session opened for user rabbitmq(uid=979) by root(uid=0) Feb 20 19:20:29 np0005625471.novalocal sshd-session[89772]: Accepted publickey for root from 38.102.83.198 port 34030 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:29 np0005625471.novalocal systemd-logind[833]: New session 223 of user root. Feb 20 19:20:29 np0005625471.novalocal systemd[1]: Started Session 223 of User root. Feb 20 19:20:29 np0005625471.novalocal sshd-session[89772]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:30 np0005625471.novalocal sshd-session[89816]: Received disconnect from 38.102.83.198 port 34030:11: disconnected by user Feb 20 19:20:30 np0005625471.novalocal sshd-session[89816]: Disconnected from user root 38.102.83.198 port 34030 Feb 20 19:20:30 np0005625471.novalocal sshd-session[89772]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:30 np0005625471.novalocal systemd-logind[833]: Session 223 logged out. Waiting for processes to exit. Feb 20 19:20:30 np0005625471.novalocal systemd[1]: session-223.scope: Deactivated successfully. Feb 20 19:20:30 np0005625471.novalocal systemd-logind[833]: Removed session 223. Feb 20 19:20:30 np0005625471.novalocal runuser[89765]: pam_unix(runuser:session): session closed for user rabbitmq Feb 20 19:20:31 np0005625471.novalocal ovs-vsctl[89897]: ovs|00001|db_ctl_base|ERR|unix:/var/run/openvswitch/db.sock: database connection failed (No such file or directory) Feb 20 19:20:31 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:20:31 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:20:31 np0005625471.novalocal container-server[83768]: Attempted to replicate 1 dbs in 0.01679 seconds (59.54484/s) Feb 20 19:20:31 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:20:31 np0005625471.novalocal container-server[83768]: 1 successes, 0 failures Feb 20 19:20:31 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:20:33 np0005625471.novalocal sshd-session[89901]: Accepted publickey for root from 38.102.83.198 port 34036 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:33 np0005625471.novalocal systemd-logind[833]: New session 224 of user root. Feb 20 19:20:33 np0005625471.novalocal systemd[1]: Started Session 224 of User root. Feb 20 19:20:33 np0005625471.novalocal sshd-session[89901]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:33 np0005625471.novalocal sshd-session[89904]: Received disconnect from 38.102.83.198 port 34036:11: disconnected by user Feb 20 19:20:33 np0005625471.novalocal sshd-session[89904]: Disconnected from user root 38.102.83.198 port 34036 Feb 20 19:20:33 np0005625471.novalocal sshd-session[89901]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:33 np0005625471.novalocal systemd[1]: session-224.scope: Deactivated successfully. Feb 20 19:20:33 np0005625471.novalocal systemd-logind[833]: Session 224 logged out. Waiting for processes to exit. Feb 20 19:20:33 np0005625471.novalocal systemd-logind[833]: Removed session 224. Feb 20 19:20:33 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:20:33 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:20:33 np0005625471.novalocal account-server[83378]: Attempted to replicate 1 dbs in 0.00808 seconds (123.78998/s) Feb 20 19:20:33 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:20:33 np0005625471.novalocal account-server[83378]: 1 successes, 0 failures Feb 20 19:20:33 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:20:34 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:34 np0005625471.novalocal systemd-sysv-generator[89973]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:34 np0005625471.novalocal systemd-rc-local-generator[89968]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:34 np0005625471.novalocal systemd[1]: Starting Open vSwitch Database Unit... Feb 20 19:20:34 np0005625471.novalocal chown[89990]: /usr/bin/chown: cannot access '/run/openvswitch': No such file or directory Feb 20 19:20:35 np0005625471.novalocal ovs-ctl[89995]: /etc/openvswitch/conf.db does not exist ... (warning). Feb 20 19:20:35 np0005625471.novalocal ovs-ctl[89995]: Creating empty database /etc/openvswitch/conf.db [ OK ] Feb 20 19:20:35 np0005625471.novalocal ovs-ctl[89995]: Starting ovsdb-server [ OK ] Feb 20 19:20:35 np0005625471.novalocal ovs-vsctl[90044]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --no-wait -- init -- set Open_vSwitch . db-version=8.5.1 Feb 20 19:20:35 np0005625471.novalocal ovs-vsctl[90060]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --no-wait set Open_vSwitch . ovs-version=3.3.5-115.el9s "external-ids:system-id=\"0f467107-62f0-47e9-b4c2-6745ea0070f8\"" "external-ids:rundir=\"/var/run/openvswitch\"" "system-type=\"centos\"" "system-version=\"9\"" Feb 20 19:20:35 np0005625471.novalocal ovs-ctl[89995]: Configuring Open vSwitch system IDs [ OK ] Feb 20 19:20:35 np0005625471.novalocal ovs-vsctl[90066]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --no-wait add Open_vSwitch . external-ids hostname=np0005625471 Feb 20 19:20:35 np0005625471.novalocal ovs-ctl[89995]: Enabling remote OVSDB managers [ OK ] Feb 20 19:20:35 np0005625471.novalocal systemd[1]: Started Open vSwitch Database Unit. Feb 20 19:20:35 np0005625471.novalocal systemd[1]: Starting Open vSwitch Delete Transient Ports... Feb 20 19:20:35 np0005625471.novalocal systemd[1]: Finished Open vSwitch Delete Transient Ports. Feb 20 19:20:35 np0005625471.novalocal systemd[1]: Starting Open vSwitch Forwarding Unit... Feb 20 19:20:35 np0005625471.novalocal kernel: openvswitch: Open vSwitch switching datapath Feb 20 19:20:35 np0005625471.novalocal ovs-ctl[90115]: Inserting openvswitch module [ OK ] Feb 20 19:20:35 np0005625471.novalocal ovs-ctl[90084]: Starting ovs-vswitchd [ OK ] Feb 20 19:20:35 np0005625471.novalocal ovs-vsctl[90132]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --no-wait add Open_vSwitch . external-ids hostname=np0005625471 Feb 20 19:20:35 np0005625471.novalocal ovs-ctl[90084]: Enabling remote OVSDB managers [ OK ] Feb 20 19:20:35 np0005625471.novalocal systemd[1]: Started Open vSwitch Forwarding Unit. Feb 20 19:20:35 np0005625471.novalocal systemd[1]: Starting Open vSwitch... Feb 20 19:20:35 np0005625471.novalocal systemd[1]: Finished Open vSwitch. Feb 20 19:20:35 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:35 np0005625471.novalocal systemd-rc-local-generator[90155]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:35 np0005625471.novalocal systemd-sysv-generator[90159]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:36 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:36 np0005625471.novalocal systemd-rc-local-generator[90189]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:36 np0005625471.novalocal systemd-sysv-generator[90195]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:36 np0005625471.novalocal sshd-session[90215]: Accepted publickey for root from 38.102.83.198 port 34050 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:36 np0005625471.novalocal systemd-logind[833]: New session 225 of user root. Feb 20 19:20:36 np0005625471.novalocal systemd[1]: Started Session 225 of User root. Feb 20 19:20:36 np0005625471.novalocal sshd-session[90215]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:36 np0005625471.novalocal sshd-session[90221]: Received disconnect from 38.102.83.198 port 34050:11: disconnected by user Feb 20 19:20:36 np0005625471.novalocal sshd-session[90221]: Disconnected from user root 38.102.83.198 port 34050 Feb 20 19:20:36 np0005625471.novalocal sshd-session[90215]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:36 np0005625471.novalocal systemd[1]: session-225.scope: Deactivated successfully. Feb 20 19:20:36 np0005625471.novalocal systemd-logind[833]: Session 225 logged out. Waiting for processes to exit. Feb 20 19:20:36 np0005625471.novalocal systemd-logind[833]: Removed session 225. Feb 20 19:20:38 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:38 np0005625471.novalocal systemd-sysv-generator[90285]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:38 np0005625471.novalocal systemd-rc-local-generator[90280]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:38 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:20:39 np0005625471.novalocal kernel: bridge: filtering via arp/ip/ip6tables is no longer available by default. Update your scripts to load br_netfilter if you need this. Feb 20 19:20:39 np0005625471.novalocal kernel: Bridge firewalling registered Feb 20 19:20:39 np0005625471.novalocal sshd-session[90310]: Accepted publickey for root from 38.102.83.198 port 34338 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:39 np0005625471.novalocal systemd-logind[833]: New session 226 of user root. Feb 20 19:20:39 np0005625471.novalocal systemd[1]: Started Session 226 of User root. Feb 20 19:20:39 np0005625471.novalocal sshd-session[90310]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:39 np0005625471.novalocal sshd-session[90319]: Received disconnect from 38.102.83.198 port 34338:11: disconnected by user Feb 20 19:20:39 np0005625471.novalocal sshd-session[90319]: Disconnected from user root 38.102.83.198 port 34338 Feb 20 19:20:39 np0005625471.novalocal sshd-session[90310]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:39 np0005625471.novalocal systemd-logind[833]: Session 226 logged out. Waiting for processes to exit. Feb 20 19:20:39 np0005625471.novalocal systemd[1]: session-226.scope: Deactivated successfully. Feb 20 19:20:39 np0005625471.novalocal systemd-logind[833]: Removed session 226. Feb 20 19:20:41 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:41 np0005625471.novalocal systemd-rc-local-generator[90376]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:41 np0005625471.novalocal systemd-sysv-generator[90381]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:41 np0005625471.novalocal systemd[1]: Queuing reload/restart jobs for marked units… Feb 20 19:20:42 np0005625471.novalocal sshd-session[90396]: Accepted publickey for root from 38.102.83.198 port 34340 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:42 np0005625471.novalocal systemd-logind[833]: New session 227 of user root. Feb 20 19:20:42 np0005625471.novalocal systemd[1]: Started Session 227 of User root. Feb 20 19:20:42 np0005625471.novalocal sshd-session[90396]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:43 np0005625471.novalocal sshd-session[90399]: Received disconnect from 38.102.83.198 port 34340:11: disconnected by user Feb 20 19:20:43 np0005625471.novalocal sshd-session[90399]: Disconnected from user root 38.102.83.198 port 34340 Feb 20 19:20:43 np0005625471.novalocal sshd-session[90396]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:43 np0005625471.novalocal systemd[1]: session-227.scope: Deactivated successfully. Feb 20 19:20:43 np0005625471.novalocal systemd-logind[833]: Session 227 logged out. Waiting for processes to exit. Feb 20 19:20:43 np0005625471.novalocal systemd-logind[833]: Removed session 227. Feb 20 19:20:43 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:20:43 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.00030994415283203125 seconds. Feb 20 19:20:43 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:20:46 np0005625471.novalocal ovs-vsctl[90529]: ovs|00001|vsctl|INFO|Called as /usr/bin/ovs-vsctl add-br br-ex Feb 20 19:20:46 np0005625471.novalocal kernel: ovs-system: entered promiscuous mode Feb 20 19:20:46 np0005625471.novalocal NetworkManager[871]: [1771633246.0460] manager: (ovs-system): 'openvswitch' plugin not available; creating generic device Feb 20 19:20:46 np0005625471.novalocal kernel: Timeout policy base is empty Feb 20 19:20:46 np0005625471.novalocal NetworkManager[871]: [1771633246.0488] manager: (ovs-system): new Generic device (/org/freedesktop/NetworkManager/Devices/3) Feb 20 19:20:46 np0005625471.novalocal systemd-udevd[90434]: Network interface NamePolicy= disabled on kernel command line. Feb 20 19:20:46 np0005625471.novalocal NetworkManager[871]: [1771633246.0807] manager: (br-ex): 'openvswitch' plugin not available; creating generic device Feb 20 19:20:46 np0005625471.novalocal kernel: br-ex: entered promiscuous mode Feb 20 19:20:46 np0005625471.novalocal NetworkManager[871]: [1771633246.0823] manager: (br-ex): new Generic device (/org/freedesktop/NetworkManager/Devices/4) Feb 20 19:20:46 np0005625471.novalocal NetworkManager[871]: [1771633246.0967] device (br-ex): carrier: link connected Feb 20 19:20:46 np0005625471.novalocal ovs-vsctl[90553]: ovs|00001|vsctl|INFO|Called as /usr/bin/ovs-vsctl br-set-external-id br-ex bridge-id br-ex Feb 20 19:20:46 np0005625471.novalocal sshd-session[90552]: Accepted publickey for root from 38.102.83.198 port 34342 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:46 np0005625471.novalocal systemd-logind[833]: New session 228 of user root. Feb 20 19:20:46 np0005625471.novalocal systemd[1]: Started Session 228 of User root. Feb 20 19:20:46 np0005625471.novalocal sshd-session[90552]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:46 np0005625471.novalocal sshd-session[90558]: Received disconnect from 38.102.83.198 port 34342:11: disconnected by user Feb 20 19:20:46 np0005625471.novalocal sshd-session[90558]: Disconnected from user root 38.102.83.198 port 34342 Feb 20 19:20:46 np0005625471.novalocal sshd-session[90552]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:46 np0005625471.novalocal systemd-logind[833]: Session 228 logged out. Waiting for processes to exit. Feb 20 19:20:46 np0005625471.novalocal systemd[1]: session-228.scope: Deactivated successfully. Feb 20 19:20:46 np0005625471.novalocal systemd-logind[833]: Removed session 228. Feb 20 19:20:46 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:20:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:46 2026 visited - attempted:0 success:0 failure:0 skipped:1 completed:0 Feb 20 19:20:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:46 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:20:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:46 2026 created - attempted:0 success:0 failure:0 Feb 20 19:20:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:46 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:20:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:46 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:20:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:46 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:20:46 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:20:46 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:20:46 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.01s Feb 20 19:20:47 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:47 np0005625471.novalocal systemd-sysv-generator[90654]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:47 np0005625471.novalocal systemd-rc-local-generator[90650]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:47 np0005625471.novalocal systemd[1]: Started OpenStack Neutron Layer 3 Agent. Feb 20 19:20:47 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:47 np0005625471.novalocal systemd-sysv-generator[90696]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:47 np0005625471.novalocal systemd-rc-local-generator[90693]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:47 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:47 np0005625471.novalocal systemd-sysv-generator[90731]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:47 np0005625471.novalocal systemd-rc-local-generator[90728]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:48 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:48 np0005625471.novalocal systemd-sysv-generator[90771]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:48 np0005625471.novalocal systemd-rc-local-generator[90767]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:48 np0005625471.novalocal systemd[1]: Starting OpenStack Neutron Open vSwitch Agent... Feb 20 19:20:48 np0005625471.novalocal neutron-enable-bridge-firewall.sh[90791]: net.bridge.bridge-nf-call-iptables = 1 Feb 20 19:20:48 np0005625471.novalocal neutron-enable-bridge-firewall.sh[90792]: net.bridge.bridge-nf-call-ip6tables = 1 Feb 20 19:20:48 np0005625471.novalocal systemd[1]: Started OpenStack Neutron Open vSwitch Agent. Feb 20 19:20:48 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:48 np0005625471.novalocal systemd-rc-local-generator[90813]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:48 np0005625471.novalocal systemd-sysv-generator[90818]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:48 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:48 np0005625471.novalocal systemd-sysv-generator[90854]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:48 np0005625471.novalocal systemd-rc-local-generator[90851]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:48 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:49 np0005625471.novalocal systemd-rc-local-generator[90891]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:49 np0005625471.novalocal systemd-sysv-generator[90894]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:49 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:49 np0005625471.novalocal systemd-rc-local-generator[90924]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:49 np0005625471.novalocal systemd-sysv-generator[90929]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:49 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:49 np0005625471.novalocal sshd-session[90948]: Accepted publickey for root from 38.102.83.198 port 51114 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:49 np0005625471.novalocal systemd-rc-local-generator[90970]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:49 np0005625471.novalocal systemd-sysv-generator[90974]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:49 np0005625471.novalocal systemd-logind[833]: New session 229 of user root. Feb 20 19:20:49 np0005625471.novalocal systemd[1]: Started Session 229 of User root. Feb 20 19:20:49 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:49 np0005625471.novalocal systemd-sysv-generator[91014]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:49 np0005625471.novalocal systemd-rc-local-generator[91011]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:50 np0005625471.novalocal sshd-session[90948]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:50 np0005625471.novalocal systemd[1]: Starting SETroubleshoot daemon for processing new SELinux denial logs... Feb 20 19:20:50 np0005625471.novalocal sshd-session[91029]: Received disconnect from 38.102.83.198 port 51114:11: disconnected by user Feb 20 19:20:50 np0005625471.novalocal sshd-session[91029]: Disconnected from user root 38.102.83.198 port 51114 Feb 20 19:20:50 np0005625471.novalocal sshd-session[90948]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:50 np0005625471.novalocal systemd[1]: session-229.scope: Deactivated successfully. Feb 20 19:20:50 np0005625471.novalocal systemd-logind[833]: Session 229 logged out. Waiting for processes to exit. Feb 20 19:20:50 np0005625471.novalocal systemd-logind[833]: Removed session 229. Feb 20 19:20:50 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:50 np0005625471.novalocal systemd-sysv-generator[91084]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:50 np0005625471.novalocal systemd-rc-local-generator[91080]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:50 np0005625471.novalocal sudo[91097]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap /etc/neutron/rootwrap.conf privsep-helper --config-file /usr/share/neutron/neutron-dist.conf --config-file /etc/neutron/neutron.conf --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-dir /etc/neutron/conf.d/neutron-openvswitch-agent --privsep_context neutron.privileged.default --privsep_sock_path /tmp/tmp95iecm4b/privsep.sock Feb 20 19:20:50 np0005625471.novalocal systemd[1]: Started Session c1 of User root. Feb 20 19:20:50 np0005625471.novalocal systemd[1]: Started OpenStack Neutron DHCP Agent. Feb 20 19:20:50 np0005625471.novalocal sudo[91097]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:20:50 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:50 np0005625471.novalocal systemd-rc-local-generator[91124]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:50 np0005625471.novalocal systemd-sysv-generator[91128]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:50 np0005625471.novalocal systemd[1]: Started SETroubleshoot daemon for processing new SELinux denial logs. Feb 20 19:20:50 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:50 np0005625471.novalocal systemd-rc-local-generator[91160]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:50 np0005625471.novalocal systemd-sysv-generator[91163]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:50 np0005625471.novalocal kernel: capability: warning: `privsep-helper' uses deprecated v2 capabilities in a way that may be insecure Feb 20 19:20:51 np0005625471.novalocal sudo[91097]: pam_unix(sudo:session): session closed for user root Feb 20 19:20:51 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:51 np0005625471.novalocal systemd-rc-local-generator[91205]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:51 np0005625471.novalocal systemd-sysv-generator[91208]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:51 np0005625471.novalocal systemd[1]: Started dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@4.service. Feb 20 19:20:51 np0005625471.novalocal systemd[1]: Started OpenStack Neutron Metadata Agent. Feb 20 19:20:51 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:51 np0005625471.novalocal systemd-sysv-generator[91256]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:51 np0005625471.novalocal systemd-rc-local-generator[91250]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:51 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:51 np0005625471.novalocal systemd-sysv-generator[91292]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:51 np0005625471.novalocal systemd-rc-local-generator[91289]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:51 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:52 np0005625471.novalocal systemd-sysv-generator[91336]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:52 np0005625471.novalocal systemd-rc-local-generator[91333]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:52 np0005625471.novalocal sudo[91351]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap /etc/neutron/rootwrap.conf privsep-helper --config-file /usr/share/neutron/neutron-dist.conf --config-file /etc/neutron/neutron.conf --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-dir /etc/neutron/conf.d/neutron-openvswitch-agent --privsep_context neutron.privileged.ovs_vsctl_cmd --privsep_sock_path /tmp/tmp43cw5eqy/privsep.sock Feb 20 19:20:52 np0005625471.novalocal systemd[1]: Started Session c2 of User root. Feb 20 19:20:52 np0005625471.novalocal systemd[1]: Started OpenStack Neutron Metering Agent. Feb 20 19:20:52 np0005625471.novalocal sudo[91351]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:20:52 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b492958-8ac4-44ad-bbb8-280146680694 Feb 20 19:20:52 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Feb 20 19:20:52 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b492958-8ac4-44ad-bbb8-280146680694 Feb 20 19:20:52 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Feb 20 19:20:52 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:52 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. For complete SELinux messages run: sealert -l fe5f7e30-0fc2-4c01-a88c-92ad0fa24832 Feb 20 19:20:52 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. ***** Plugin dac_override (53.1 confidence) suggests ********************** If you want to help identify if domain needs this access or you have a file with the wrong permissions on your system Then turn on full auditing to get path information about the offending file and generate the error again. Do Turn on full auditing # auditctl -w /etc/shadow -p w Try to recreate AVC. Then execute # ausearch -m avc -ts recent If you see PATH record check ownership/permissions on file, and fix it, otherwise report as a bugzilla. ***** Plugin catchall_boolean (42.6 confidence) suggests ****************** If you want to allow os to neutron dac override Then you must tell SELinux about this by enabling the 'os_neutron_dac_override' boolean. Do setsebool -P os_neutron_dac_override 1 ***** Plugin catchall (5.76 confidence) suggests ************************** If you believe that python3.9 should have the dac_override capability by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:52 np0005625471.novalocal systemd-sysv-generator[91381]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:52 np0005625471.novalocal systemd-rc-local-generator[91375]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:52 np0005625471.novalocal systemd[1]: Reloading. Feb 20 19:20:52 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:20:52 np0005625471.novalocal object-server[84159]: 1/1 (100.00%) partitions replicated in 0.00s (790.48/sec, 0s remaining) Feb 20 19:20:52 np0005625471.novalocal object-server[84159]: 0 successes, 0 failures Feb 20 19:20:52 np0005625471.novalocal object-server[84159]: 1 suffixes checked - 0.00% hashed, 0.00% synced Feb 20 19:20:52 np0005625471.novalocal object-server[84159]: Partition times: max 0.0005s, min 0.0005s, med 0.0005s Feb 20 19:20:52 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:20:52 np0005625471.novalocal systemd-rc-local-generator[91416]: /etc/rc.d/rc.local is not marked executable, skipping. Feb 20 19:20:52 np0005625471.novalocal systemd-sysv-generator[91419]: SysV service '/etc/rc.d/init.d/network' lacks a native systemd unit file. Automatically generating a unit file for compatibility. Please update package to include a native systemd unit file, in order to make it more safe and robust. Feb 20 19:20:52 np0005625471.novalocal sudo[91351]: pam_unix(sudo:session): session closed for user root Feb 20 19:20:53 np0005625471.novalocal ovs-vsctl[91446]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --timeout=10 --id=@manager -- create Manager "target=\"ptcp:6640:127.0.0.1\"" -- add Open_vSwitch . manager_options @manager -- set Manager ptcp:6640:127.0.0.1 inactivity_probe=10000 Feb 20 19:20:53 np0005625471.novalocal kernel: br-int: entered promiscuous mode Feb 20 19:20:53 np0005625471.novalocal NetworkManager[871]: [1771633253.0578] manager: (br-int): 'openvswitch' plugin not available; creating generic device Feb 20 19:20:53 np0005625471.novalocal NetworkManager[871]: [1771633253.0597] manager: (br-int): new Generic device (/org/freedesktop/NetworkManager/Devices/5) Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b492958-8ac4-44ad-bbb8-280146680694 Feb 20 19:20:53 np0005625471.novalocal systemd-udevd[91449]: Network interface NamePolicy= disabled on kernel command line. Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from create access on the file /(null). For complete SELinux messages run: sealert -l 55d85264-854a-4d97-ac25-98c7ac88e0a1 Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from create access on the file /(null). ***** Plugin restorecon (99.5 confidence) suggests ************************ If you want to fix the label. /(null) default label should be etc_runtime_t. Then you can run restorecon. The access attempt may have been stopped due to insufficient permissions to access a parent directory in which case try to change the following command accordingly. Do # /sbin/restorecon -v /(null) ***** Plugin catchall (1.49 confidence) suggests ************************** If you believe that python3.9 should be allowed create access on the (null) file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from 'write, open' accesses on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l b27ee6a5-9e0f-4c38-8e99-56e4559a0b22 Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from 'write, open' accesses on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed write open access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l 474911a2-000a-498c-b094-5d0c3ed4374f Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from ioctl access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l 9e89377e-85b4-4475-b593-4d7a43c625e6 Feb 20 19:20:53 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from ioctl access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed ioctl access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:53 np0005625471.novalocal sshd-session[91455]: Accepted publickey for root from 38.102.83.198 port 51124 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:53 np0005625471.novalocal systemd-logind[833]: New session 230 of user root. Feb 20 19:20:53 np0005625471.novalocal systemd[1]: Started Session 230 of User root. Feb 20 19:20:53 np0005625471.novalocal sshd-session[91455]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:53 np0005625471.novalocal sudo[91481]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap /etc/neutron/rootwrap.conf privsep-helper --config-file /usr/share/neutron/neutron-dist.conf --config-file /etc/neutron/neutron.conf --config-file /etc/neutron/dhcp_agent.ini --config-dir /etc/neutron/conf.d/neutron-dhcp-agent --privsep_context neutron.privileged.default --privsep_sock_path /tmp/tmp7sukwrfn/privsep.sock Feb 20 19:20:53 np0005625471.novalocal sshd-session[91458]: Received disconnect from 38.102.83.198 port 51124:11: disconnected by user Feb 20 19:20:53 np0005625471.novalocal sshd-session[91458]: Disconnected from user root 38.102.83.198 port 51124 Feb 20 19:20:53 np0005625471.novalocal sshd-session[91455]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:53 np0005625471.novalocal systemd[1]: session-230.scope: Deactivated successfully. Feb 20 19:20:53 np0005625471.novalocal systemd-logind[833]: Session 230 logged out. Waiting for processes to exit. Feb 20 19:20:53 np0005625471.novalocal systemd[1]: Started Session c3 of User root. Feb 20 19:20:53 np0005625471.novalocal systemd-logind[833]: Removed session 230. Feb 20 19:20:53 np0005625471.novalocal sudo[91481]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:20:53 np0005625471.novalocal sudo[91481]: pam_unix(sudo:session): session closed for user root Feb 20 19:20:54 np0005625471.novalocal sudo[91497]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap /etc/neutron/rootwrap.conf privsep-helper --config-file /usr/share/neutron/neutron-dist.conf --config-file /etc/neutron/neutron.conf --config-file /etc/neutron/dhcp_agent.ini --config-dir /etc/neutron/conf.d/neutron-dhcp-agent --privsep_context neutron.privileged.namespace_cmd --privsep_sock_path /tmp/tmp4a8a6954/privsep.sock Feb 20 19:20:54 np0005625471.novalocal systemd[1]: Started Session c4 of User root. Feb 20 19:20:54 np0005625471.novalocal sudo[91499]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap /etc/neutron/rootwrap.conf privsep-helper --config-file /usr/share/neutron/neutron-dist.conf --config-file /etc/neutron/neutron.conf --config-dir /etc/neutron/conf.d/neutron-l3-agent --privsep_context neutron.privileged.namespace_cmd --privsep_sock_path /tmp/tmpvlswvlf5/privsep.sock Feb 20 19:20:54 np0005625471.novalocal sudo[91497]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:20:54 np0005625471.novalocal systemd[1]: Started Session c5 of User root. Feb 20 19:20:54 np0005625471.novalocal sudo[91499]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:20:54 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b492958-8ac4-44ad-bbb8-280146680694 Feb 20 19:20:54 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Feb 20 19:20:54 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. For complete SELinux messages run: sealert -l fe5f7e30-0fc2-4c01-a88c-92ad0fa24832 Feb 20 19:20:54 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. ***** Plugin dac_override (53.1 confidence) suggests ********************** If you want to help identify if domain needs this access or you have a file with the wrong permissions on your system Then turn on full auditing to get path information about the offending file and generate the error again. Do Turn on full auditing # auditctl -w /etc/shadow -p w Try to recreate AVC. Then execute # ausearch -m avc -ts recent If you see PATH record check ownership/permissions on file, and fix it, otherwise report as a bugzilla. ***** Plugin catchall_boolean (42.6 confidence) suggests ****************** If you want to allow os to neutron dac override Then you must tell SELinux about this by enabling the 'os_neutron_dac_override' boolean. Do setsebool -P os_neutron_dac_override 1 ***** Plugin catchall (5.76 confidence) suggests ************************** If you believe that python3.9 should have the dac_override capability by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:54 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. For complete SELinux messages run: sealert -l fe5f7e30-0fc2-4c01-a88c-92ad0fa24832 Feb 20 19:20:54 np0005625471.novalocal object-server[89549]: Begin object audit "forever" mode (ZBF) Feb 20 19:20:54 np0005625471.novalocal object-server[89549]: Object audit (ZBF). Since Sat Feb 21 00:20:54 2026: Locally: 1 passed, 0 quarantined, 0 errors, files/sec: 1176.85, bytes/sec: 0.00, Total time: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:20:54 np0005625471.novalocal object-server[89549]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 597.73, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.21 Feb 20 19:20:54 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. ***** Plugin dac_override (53.1 confidence) suggests ********************** If you want to help identify if domain needs this access or you have a file with the wrong permissions on your system Then turn on full auditing to get path information about the offending file and generate the error again. Do Turn on full auditing # auditctl -w /etc/shadow -p w Try to recreate AVC. Then execute # ausearch -m avc -ts recent If you see PATH record check ownership/permissions on file, and fix it, otherwise report as a bugzilla. ***** Plugin catchall_boolean (42.6 confidence) suggests ****************** If you want to allow os to neutron dac override Then you must tell SELinux about this by enabling the 'os_neutron_dac_override' boolean. Do setsebool -P os_neutron_dac_override 1 ***** Plugin catchall (5.76 confidence) suggests ************************** If you believe that python3.9 should have the dac_override capability by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:55 np0005625471.novalocal sudo[91497]: pam_unix(sudo:session): session closed for user root Feb 20 19:20:55 np0005625471.novalocal kernel: br-tun: entered promiscuous mode Feb 20 19:20:55 np0005625471.novalocal NetworkManager[871]: [1771633255.2350] manager: (br-tun): 'openvswitch' plugin not available; creating generic device Feb 20 19:20:55 np0005625471.novalocal NetworkManager[871]: [1771633255.2365] manager: (br-tun): new Generic device (/org/freedesktop/NetworkManager/Devices/6) Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. For complete SELinux messages run: sealert -l fe5f7e30-0fc2-4c01-a88c-92ad0fa24832 Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. ***** Plugin dac_override (53.1 confidence) suggests ********************** If you want to help identify if domain needs this access or you have a file with the wrong permissions on your system Then turn on full auditing to get path information about the offending file and generate the error again. Do Turn on full auditing # auditctl -w /etc/shadow -p w Try to recreate AVC. Then execute # ausearch -m avc -ts recent If you see PATH record check ownership/permissions on file, and fix it, otherwise report as a bugzilla. ***** Plugin catchall_boolean (42.6 confidence) suggests ****************** If you want to allow os to neutron dac override Then you must tell SELinux about this by enabling the 'os_neutron_dac_override' boolean. Do setsebool -P os_neutron_dac_override 1 ***** Plugin catchall (5.76 confidence) suggests ************************** If you believe that python3.9 should have the dac_override capability by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:55 np0005625471.novalocal sudo[91499]: pam_unix(sudo:session): session closed for user root Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b492958-8ac4-44ad-bbb8-280146680694 Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the file 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l d97cf296-281a-4359-9b14-2a20d6fc405d Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the file 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from open access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l c456cbe7-6d75-448d-9eba-43d4c100f2e8 Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from open access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed open access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l 474911a2-000a-498c-b094-5d0c3ed4374f Feb 20 19:20:55 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:56 np0005625471.novalocal sudo[91522]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap /etc/neutron/rootwrap.conf privsep-helper --config-file /usr/share/neutron/neutron-dist.conf --config-file /etc/neutron/neutron.conf --config-file /etc/neutron/dhcp_agent.ini --config-dir /etc/neutron/conf.d/neutron-dhcp-agent --privsep_context neutron.privileged.link_cmd --privsep_sock_path /tmp/tmpb97sa0wq/privsep.sock Feb 20 19:20:56 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from ioctl access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l 9e89377e-85b4-4475-b593-4d7a43c625e6 Feb 20 19:20:56 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from ioctl access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed ioctl access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:56 np0005625471.novalocal systemd[1]: Started Session c6 of User root. Feb 20 19:20:56 np0005625471.novalocal sudo[91522]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:20:56 np0005625471.novalocal sshd-session[91528]: Accepted publickey for root from 38.102.83.198 port 51140 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:56 np0005625471.novalocal systemd-logind[833]: New session 231 of user root. Feb 20 19:20:56 np0005625471.novalocal systemd[1]: Started Session 231 of User root. Feb 20 19:20:56 np0005625471.novalocal sshd-session[91528]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:56 np0005625471.novalocal sshd-session[91532]: Received disconnect from 38.102.83.198 port 51140:11: disconnected by user Feb 20 19:20:56 np0005625471.novalocal sshd-session[91532]: Disconnected from user root 38.102.83.198 port 51140 Feb 20 19:20:56 np0005625471.novalocal sshd-session[91528]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:56 np0005625471.novalocal systemd[1]: session-231.scope: Deactivated successfully. Feb 20 19:20:56 np0005625471.novalocal systemd-logind[833]: Session 231 logged out. Waiting for processes to exit. Feb 20 19:20:56 np0005625471.novalocal systemd-logind[833]: Removed session 231. Feb 20 19:20:56 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. For complete SELinux messages run: sealert -l fe5f7e30-0fc2-4c01-a88c-92ad0fa24832 Feb 20 19:20:56 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. ***** Plugin dac_override (53.1 confidence) suggests ********************** If you want to help identify if domain needs this access or you have a file with the wrong permissions on your system Then turn on full auditing to get path information about the offending file and generate the error again. Do Turn on full auditing # auditctl -w /etc/shadow -p w Try to recreate AVC. Then execute # ausearch -m avc -ts recent If you see PATH record check ownership/permissions on file, and fix it, otherwise report as a bugzilla. ***** Plugin catchall_boolean (42.6 confidence) suggests ****************** If you want to allow os to neutron dac override Then you must tell SELinux about this by enabling the 'os_neutron_dac_override' boolean. Do setsebool -P os_neutron_dac_override 1 ***** Plugin catchall (5.76 confidence) suggests ************************** If you believe that python3.9 should have the dac_override capability by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:20:56 np0005625471.novalocal ovs-vsctl[91573]: ovs|00001|vsctl|INFO|Called as ovs-vsctl --timeout=10 --id=@manager -- create Manager "target=\"ptcp:6640:127.0.0.1\"" -- add Open_vSwitch . manager_options @manager -- set Manager ptcp:6640:127.0.0.1 inactivity_probe=10000 Feb 20 19:20:56 np0005625471.novalocal ovs-vsctl[91573]: ovs|00002|db_ctl_base|ERR|multiple rows in Manager match "ptcp:6640:127.0.0.1" Feb 20 19:20:56 np0005625471.novalocal sudo[91522]: pam_unix(sudo:session): session closed for user root Feb 20 19:20:57 np0005625471.novalocal sudo[91581]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap /etc/neutron/rootwrap.conf privsep-helper --config-file /usr/share/neutron/neutron-dist.conf --config-file /etc/neutron/neutron.conf --config-dir /etc/neutron/conf.d/neutron-l3-agent --privsep_context neutron.privileged.default --privsep_sock_path /tmp/tmpqz35w9x4/privsep.sock Feb 20 19:20:57 np0005625471.novalocal systemd[1]: Started Session c7 of User root. Feb 20 19:20:57 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b492958-8ac4-44ad-bbb8-280146680694 Feb 20 19:20:57 np0005625471.novalocal sudo[91581]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:20:57 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Feb 20 19:20:58 np0005625471.novalocal sudo[91581]: pam_unix(sudo:session): session closed for user root Feb 20 19:20:58 np0005625471.novalocal kernel: tap3edf3338-2d: entered promiscuous mode Feb 20 19:20:58 np0005625471.novalocal NetworkManager[871]: [1771633258.8200] manager: (tap3edf3338-2d): 'openvswitch' plugin not available; creating generic device Feb 20 19:20:58 np0005625471.novalocal NetworkManager[871]: [1771633258.8217] manager: (tap3edf3338-2d): new Generic device (/org/freedesktop/NetworkManager/Devices/7) Feb 20 19:20:59 np0005625471.novalocal sudo[91640]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap /etc/neutron/rootwrap.conf privsep-helper --config-file /usr/share/neutron/neutron-dist.conf --config-file /etc/neutron/neutron.conf --config-dir /etc/neutron/conf.d/neutron-l3-agent --privsep_context neutron.privileged.link_cmd --privsep_sock_path /tmp/tmps2a_8aox/privsep.sock Feb 20 19:20:59 np0005625471.novalocal systemd[1]: Started Session c8 of User root. Feb 20 19:20:59 np0005625471.novalocal sudo[91640]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:20:59 np0005625471.novalocal sudo[91648]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap-daemon /etc/neutron/rootwrap.conf Feb 20 19:20:59 np0005625471.novalocal systemd[1]: Started Session c9 of User root. Feb 20 19:20:59 np0005625471.novalocal sudo[91648]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:20:59 np0005625471.novalocal sshd-session[91656]: Accepted publickey for root from 38.102.83.198 port 47224 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:20:59 np0005625471.novalocal systemd-logind[833]: New session 232 of user root. Feb 20 19:20:59 np0005625471.novalocal systemd[1]: Started Session 232 of User root. Feb 20 19:20:59 np0005625471.novalocal sshd-session[91656]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:20:59 np0005625471.novalocal dnsmasq[91671]: started, version 2.85 cachesize 150 Feb 20 19:20:59 np0005625471.novalocal dnsmasq[91671]: DNS service limited to local subnets Feb 20 19:20:59 np0005625471.novalocal dnsmasq[91671]: compile time options: IPv6 GNU-getopt DBus no-UBus no-i18n IDN2 DHCP DHCPv6 no-Lua TFTP no-conntrack ipset auth cryptohash DNSSEC loop-detect inotify dumpfile Feb 20 19:20:59 np0005625471.novalocal dnsmasq[91671]: warning: no upstream servers configured Feb 20 19:20:59 np0005625471.novalocal dnsmasq-dhcp[91671]: DHCP, static leases only on 10.0.0.0, lease time 1d Feb 20 19:20:59 np0005625471.novalocal dnsmasq[91671]: read /var/lib/neutron/dhcp/922bba97-ee25-4f14-a4da-b72f794ae54a/addn_hosts - 1 addresses Feb 20 19:20:59 np0005625471.novalocal dnsmasq-dhcp[91671]: read /var/lib/neutron/dhcp/922bba97-ee25-4f14-a4da-b72f794ae54a/host Feb 20 19:20:59 np0005625471.novalocal dnsmasq-dhcp[91671]: read /var/lib/neutron/dhcp/922bba97-ee25-4f14-a4da-b72f794ae54a/opts Feb 20 19:20:59 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/sbin/dnsmasq from using the dac_override capability. For complete SELinux messages run: sealert -l 9a882535-da7c-4999-8ab2-48cd52a36bdb Feb 20 19:20:59 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/sbin/dnsmasq from using the dac_override capability. ***** Plugin dac_override (53.1 confidence) suggests ********************** If you want to help identify if domain needs this access or you have a file with the wrong permissions on your system Then turn on full auditing to get path information about the offending file and generate the error again. Do Turn on full auditing # auditctl -w /etc/shadow -p w Try to recreate AVC. Then execute # ausearch -m avc -ts recent If you see PATH record check ownership/permissions on file, and fix it, otherwise report as a bugzilla. ***** Plugin catchall_boolean (42.6 confidence) suggests ****************** If you want to allow os to dnsmasq dac override Then you must tell SELinux about this by enabling the 'os_dnsmasq_dac_override' boolean. Do setsebool -P os_dnsmasq_dac_override 1 ***** Plugin catchall (5.76 confidence) suggests ************************** If you believe that dnsmasq should have the dac_override capability by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'dnsmasq' --raw | audit2allow -M my-dnsmasq # semodule -X 300 -i my-dnsmasq.pp Feb 20 19:20:59 np0005625471.novalocal sshd-session[91669]: Received disconnect from 38.102.83.198 port 47224:11: disconnected by user Feb 20 19:20:59 np0005625471.novalocal sshd-session[91669]: Disconnected from user root 38.102.83.198 port 47224 Feb 20 19:20:59 np0005625471.novalocal sshd-session[91656]: pam_unix(sshd:session): session closed for user root Feb 20 19:20:59 np0005625471.novalocal systemd[1]: session-232.scope: Deactivated successfully. Feb 20 19:20:59 np0005625471.novalocal systemd-logind[833]: Session 232 logged out. Waiting for processes to exit. Feb 20 19:20:59 np0005625471.novalocal systemd-logind[833]: Removed session 232. Feb 20 19:20:59 np0005625471.novalocal sudo[91640]: pam_unix(sudo:session): session closed for user root Feb 20 19:20:59 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. For complete SELinux messages run: sealert -l fe5f7e30-0fc2-4c01-a88c-92ad0fa24832 Feb 20 19:21:00 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from using the dac_override capability. ***** Plugin dac_override (53.1 confidence) suggests ********************** If you want to help identify if domain needs this access or you have a file with the wrong permissions on your system Then turn on full auditing to get path information about the offending file and generate the error again. Do Turn on full auditing # auditctl -w /etc/shadow -p w Try to recreate AVC. Then execute # ausearch -m avc -ts recent If you see PATH record check ownership/permissions on file, and fix it, otherwise report as a bugzilla. ***** Plugin catchall_boolean (42.6 confidence) suggests ****************** If you want to allow os to neutron dac override Then you must tell SELinux about this by enabling the 'os_neutron_dac_override' boolean. Do setsebool -P os_neutron_dac_override 1 ***** Plugin catchall (5.76 confidence) suggests ************************** If you believe that python3.9 should have the dac_override capability by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:21:00 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. For complete SELinux messages run: sealert -l 1b492958-8ac4-44ad-bbb8-280146680694 Feb 20 19:21:01 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the lnk_file /usr/bin/debuginfo-install. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the debuginfo-install lnk_file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'neutron-server' --raw | audit2allow -M my-neutronserver # semodule -X 300 -i my-neutronserver.pp Feb 20 19:21:01 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the file 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l d97cf296-281a-4359-9b14-2a20d6fc405d Feb 20 19:21:01 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from read access on the file 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed read access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:21:01 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from open access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l c456cbe7-6d75-448d-9eba-43d4c100f2e8 Feb 20 19:21:01 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from open access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed open access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:21:01 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l 474911a2-000a-498c-b094-5d0c3ed4374f Feb 20 19:21:01 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from getattr access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed getattr access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:21:01 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:21:01 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:21:01 np0005625471.novalocal container-server[83768]: Attempted to replicate 1 dbs in 0.01103 seconds (90.68095/s) Feb 20 19:21:01 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:21:01 np0005625471.novalocal container-server[83768]: 1 successes, 0 failures Feb 20 19:21:01 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:21:01 np0005625471.novalocal kernel: qr-7b3d29c4-d0: entered promiscuous mode Feb 20 19:21:01 np0005625471.novalocal NetworkManager[871]: [1771633261.9486] manager: (qr-7b3d29c4-d0): 'openvswitch' plugin not available; creating generic device Feb 20 19:21:01 np0005625471.novalocal NetworkManager[871]: [1771633261.9497] manager: (qr-7b3d29c4-d0): new Generic device (/org/freedesktop/NetworkManager/Devices/8) Feb 20 19:21:01 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from ioctl access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. For complete SELinux messages run: sealert -l 9e89377e-85b4-4475-b593-4d7a43c625e6 Feb 20 19:21:01 np0005625471.novalocal systemd[1]: Starting system activity accounting tool... Feb 20 19:21:01 np0005625471.novalocal systemd[1]: sysstat-collect.service: Deactivated successfully. Feb 20 19:21:01 np0005625471.novalocal systemd[1]: Finished system activity accounting tool. Feb 20 19:21:01 np0005625471.novalocal setroubleshoot[91030]: SELinux is preventing /usr/bin/python3.9 from ioctl access on the file /root/.cache/python-entrypoints/7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c. ***** Plugin catchall (100. confidence) suggests ************************** If you believe that python3.9 should be allowed ioctl access on the 7731e75ce7c2789d885d1f5dfe1c12e4f19ddc4f956fbb840a5e3c6d148abb4c file by default. Then you should report this as a bug. You can generate a local policy module to allow this access. Do allow this access for now by executing: # ausearch -c 'privsep-helper' --raw | audit2allow -M my-privsephelper # semodule -X 300 -i my-privsephelper.pp Feb 20 19:21:02 np0005625471.novalocal kernel: qg-57912d5e-46: entered promiscuous mode Feb 20 19:21:02 np0005625471.novalocal NetworkManager[871]: [1771633262.3051] manager: (qg-57912d5e-46): 'openvswitch' plugin not available; creating generic device Feb 20 19:21:02 np0005625471.novalocal NetworkManager[871]: [1771633262.3072] manager: (qg-57912d5e-46): new Generic device (/org/freedesktop/NetworkManager/Devices/9) Feb 20 19:21:02 np0005625471.novalocal systemd-udevd[91738]: Network interface NamePolicy= disabled on kernel command line. Feb 20 19:21:02 np0005625471.novalocal sshd-session[91790]: Accepted publickey for root from 38.102.83.198 port 47240 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:21:03 np0005625471.novalocal systemd-logind[833]: New session 233 of user root. Feb 20 19:21:03 np0005625471.novalocal systemd[1]: Started Session 233 of User root. Feb 20 19:21:03 np0005625471.novalocal sshd-session[91790]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:21:03 np0005625471.novalocal sshd-session[91802]: Received disconnect from 38.102.83.198 port 47240:11: disconnected by user Feb 20 19:21:03 np0005625471.novalocal sshd-session[91802]: Disconnected from user root 38.102.83.198 port 47240 Feb 20 19:21:03 np0005625471.novalocal sshd-session[91790]: pam_unix(sshd:session): session closed for user root Feb 20 19:21:03 np0005625471.novalocal systemd-logind[833]: Session 233 logged out. Waiting for processes to exit. Feb 20 19:21:03 np0005625471.novalocal systemd[1]: session-233.scope: Deactivated successfully. Feb 20 19:21:03 np0005625471.novalocal systemd-logind[833]: Removed session 233. Feb 20 19:21:03 np0005625471.novalocal sudo[91847]: neutron : PWD=/ ; USER=root ; COMMAND=/usr/bin/neutron-rootwrap-daemon /etc/neutron/rootwrap.conf Feb 20 19:21:03 np0005625471.novalocal systemd[1]: Started Session c10 of User root. Feb 20 19:21:03 np0005625471.novalocal sudo[91847]: pam_unix(sudo:session): session opened for user root(uid=0) by (uid=982) Feb 20 19:21:03 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:21:03 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:21:03 np0005625471.novalocal account-server[83378]: Attempted to replicate 1 dbs in 0.00648 seconds (154.26803/s) Feb 20 19:21:03 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:21:03 np0005625471.novalocal account-server[83378]: 1 successes, 0 failures Feb 20 19:21:03 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:21:06 np0005625471.novalocal systemd[1]: session-219.scope: Deactivated successfully. Feb 20 19:21:06 np0005625471.novalocal systemd[1]: session-219.scope: Consumed 32.417s CPU time. Feb 20 19:21:06 np0005625471.novalocal systemd-logind[833]: Removed session 219. Feb 20 19:21:06 np0005625471.novalocal sshd-session[91881]: Accepted publickey for root from 38.102.83.198 port 47252 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:21:06 np0005625471.novalocal systemd-logind[833]: New session 234 of user root. Feb 20 19:21:06 np0005625471.novalocal systemd[1]: Started Session 234 of User root. Feb 20 19:21:06 np0005625471.novalocal sshd-session[91881]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:21:06 np0005625471.novalocal sshd-session[91885]: Received disconnect from 38.102.83.198 port 47252:11: disconnected by user Feb 20 19:21:06 np0005625471.novalocal sshd-session[91885]: Disconnected from user root 38.102.83.198 port 47252 Feb 20 19:21:06 np0005625471.novalocal sshd-session[91881]: pam_unix(sshd:session): session closed for user root Feb 20 19:21:06 np0005625471.novalocal systemd[1]: session-234.scope: Deactivated successfully. Feb 20 19:21:06 np0005625471.novalocal systemd-logind[833]: Session 234 logged out. Waiting for processes to exit. Feb 20 19:21:06 np0005625471.novalocal systemd-logind[833]: Removed session 234. Feb 20 19:21:06 np0005625471.novalocal sshd-session[91916]: Accepted publickey for root from 38.102.83.198 port 47260 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:21:06 np0005625471.novalocal systemd-logind[833]: New session 235 of user root. Feb 20 19:21:06 np0005625471.novalocal systemd[1]: Started Session 235 of User root. Feb 20 19:21:06 np0005625471.novalocal sshd-session[91916]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:21:06 np0005625471.novalocal sshd-session[91919]: Received disconnect from 38.102.83.198 port 47260:11: disconnected by user Feb 20 19:21:06 np0005625471.novalocal sshd-session[91919]: Disconnected from user root 38.102.83.198 port 47260 Feb 20 19:21:06 np0005625471.novalocal sshd-session[91916]: pam_unix(sshd:session): session closed for user root Feb 20 19:21:06 np0005625471.novalocal systemd-logind[833]: Session 235 logged out. Waiting for processes to exit. Feb 20 19:21:07 np0005625471.novalocal sshd-session[91955]: Accepted publickey for root from 38.102.83.198 port 47276 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:21:07 np0005625471.novalocal systemd-logind[833]: New session 236 of user root. Feb 20 19:21:07 np0005625471.novalocal systemd[1]: Started Session 236 of User root. Feb 20 19:21:07 np0005625471.novalocal sshd-session[91955]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:21:07 np0005625471.novalocal sshd-session[91960]: Received disconnect from 38.102.83.198 port 47276:11: disconnected by user Feb 20 19:21:07 np0005625471.novalocal sshd-session[91960]: Disconnected from user root 38.102.83.198 port 47276 Feb 20 19:21:07 np0005625471.novalocal sshd-session[91955]: pam_unix(sshd:session): session closed for user root Feb 20 19:21:07 np0005625471.novalocal systemd-logind[833]: Session 236 logged out. Waiting for processes to exit. Feb 20 19:21:07 np0005625471.novalocal systemd[1]: session-236.scope: Deactivated successfully. Feb 20 19:21:07 np0005625471.novalocal systemd-logind[833]: Removed session 236. Feb 20 19:21:10 np0005625471.novalocal sshd-session[92082]: Accepted publickey for root from 38.102.83.198 port 47100 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:21:10 np0005625471.novalocal systemd-logind[833]: New session 237 of user root. Feb 20 19:21:10 np0005625471.novalocal systemd[1]: Started Session 237 of User root. Feb 20 19:21:10 np0005625471.novalocal sshd-session[92082]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:21:10 np0005625471.novalocal sshd-session[92097]: Received disconnect from 38.102.83.198 port 47100:11: disconnected by user Feb 20 19:21:10 np0005625471.novalocal sshd-session[92097]: Disconnected from user root 38.102.83.198 port 47100 Feb 20 19:21:10 np0005625471.novalocal sshd-session[92082]: pam_unix(sshd:session): session closed for user root Feb 20 19:21:10 np0005625471.novalocal systemd[1]: session-237.scope: Deactivated successfully. Feb 20 19:21:10 np0005625471.novalocal systemd-logind[833]: Session 237 logged out. Waiting for processes to exit. Feb 20 19:21:10 np0005625471.novalocal systemd-logind[833]: Removed session 237. Feb 20 19:21:12 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@4.service: Deactivated successfully. Feb 20 19:21:12 np0005625471.novalocal systemd[1]: dbus-:1.1-org.fedoraproject.SetroubleshootPrivileged@4.service: Consumed 1.075s CPU time. Feb 20 19:21:12 np0005625471.novalocal systemd[1]: setroubleshootd.service: Deactivated successfully. Feb 20 19:21:12 np0005625471.novalocal systemd[1]: setroubleshootd.service: Consumed 1.848s CPU time. Feb 20 19:21:13 np0005625471.novalocal sshd-session[92135]: Accepted publickey for root from 38.102.83.198 port 47116 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:21:13 np0005625471.novalocal systemd-logind[833]: New session 238 of user root. Feb 20 19:21:13 np0005625471.novalocal systemd[1]: Started Session 238 of User root. Feb 20 19:21:13 np0005625471.novalocal sshd-session[92135]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:21:13 np0005625471.novalocal object-server[83104]: Starting object reconstruction pass. Feb 20 19:21:13 np0005625471.novalocal object-server[83104]: Nothing reconstructed for 0.0003864765167236328 seconds. Feb 20 19:21:13 np0005625471.novalocal object-server[83104]: Object reconstruction complete. (0.00 minutes) Feb 20 19:21:13 np0005625471.novalocal sshd-session[92138]: Received disconnect from 38.102.83.198 port 47116:11: disconnected by user Feb 20 19:21:13 np0005625471.novalocal sshd-session[92138]: Disconnected from user root 38.102.83.198 port 47116 Feb 20 19:21:13 np0005625471.novalocal sshd-session[92135]: pam_unix(sshd:session): session closed for user root Feb 20 19:21:13 np0005625471.novalocal systemd[1]: session-238.scope: Deactivated successfully. Feb 20 19:21:13 np0005625471.novalocal systemd-logind[833]: Session 238 logged out. Waiting for processes to exit. Feb 20 19:21:13 np0005625471.novalocal systemd-logind[833]: Removed session 238. Feb 20 19:21:13 np0005625471.novalocal systemd[1]: run-netns-testns\x2d706624420.mount: Deactivated successfully. Feb 20 19:21:15 np0005625471.novalocal systemd[1]: run-netns-testns\x2d647408700.mount: Deactivated successfully. Feb 20 19:21:15 np0005625471.novalocal systemd[1]: run-netns-testns\x2d1648099284.mount: Deactivated successfully. Feb 20 19:21:15 np0005625471.novalocal runuser[92232]: pam_unix(runuser:session): session opened for user rabbitmq(uid=979) by root(uid=0) Feb 20 19:21:16 np0005625471.novalocal runuser[92232]: pam_unix(runuser:session): session closed for user rabbitmq Feb 20 19:21:16 np0005625471.novalocal runuser[92285]: pam_unix(runuser:session): session opened for user rabbitmq(uid=979) by root(uid=0) Feb 20 19:21:16 np0005625471.novalocal container-server[82834]: Container sharder cycle starting, auto-sharding False Feb 20 19:21:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:21:16 2026 visited - attempted:0 success:0 failure:0 skipped:1 completed:0 Feb 20 19:21:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:21:16 2026 scanned - attempted:0 success:0 failure:0 found:0 min_time:0 max_time:0 Feb 20 19:21:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:21:16 2026 created - attempted:0 success:0 failure:0 Feb 20 19:21:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:21:16 2026 cleaved - attempted:0 success:0 failure:0 min_time:0 max_time:0 Feb 20 19:21:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:21:16 2026 misplaced - attempted:0 success:0 failure:0 found:0 placed:0 unplaced:0 Feb 20 19:21:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:21:16 2026 audit_root - attempted:0 success:0 failure:0 has_overlap:0 num_overlap:0 Feb 20 19:21:16 np0005625471.novalocal container-server[82834]: Since Sat Feb 21 00:21:16 2026 audit_shard - attempted:0 success:0 failure:0 Feb 20 19:21:16 np0005625471.novalocal container-server[82834]: Container sharder cycle completed: 0.01s Feb 20 19:21:16 np0005625471.novalocal sshd-session[92333]: Accepted publickey for root from 38.102.83.198 port 47120 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:21:16 np0005625471.novalocal systemd-logind[833]: New session 239 of user root. Feb 20 19:21:16 np0005625471.novalocal systemd[1]: Started Session 239 of User root. Feb 20 19:21:16 np0005625471.novalocal sshd-session[92333]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:21:17 np0005625471.novalocal sshd-session[92336]: Received disconnect from 38.102.83.198 port 47120:11: disconnected by user Feb 20 19:21:17 np0005625471.novalocal sshd-session[92336]: Disconnected from user root 38.102.83.198 port 47120 Feb 20 19:21:17 np0005625471.novalocal sshd-session[92333]: pam_unix(sshd:session): session closed for user root Feb 20 19:21:17 np0005625471.novalocal systemd[1]: session-239.scope: Deactivated successfully. Feb 20 19:21:17 np0005625471.novalocal systemd-logind[833]: Session 239 logged out. Waiting for processes to exit. Feb 20 19:21:17 np0005625471.novalocal systemd-logind[833]: Removed session 239. Feb 20 19:21:17 np0005625471.novalocal runuser[92285]: pam_unix(runuser:session): session closed for user rabbitmq Feb 20 19:21:17 np0005625471.novalocal runuser[92373]: pam_unix(runuser:session): session opened for user rabbitmq(uid=979) by root(uid=0) Feb 20 19:21:17 np0005625471.novalocal runuser[92373]: pam_unix(runuser:session): session closed for user rabbitmq Feb 20 19:21:20 np0005625471.novalocal sshd-session[92441]: Accepted publickey for root from 38.102.83.198 port 55306 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:21:20 np0005625471.novalocal systemd-logind[833]: New session 240 of user root. Feb 20 19:21:20 np0005625471.novalocal systemd[1]: Started Session 240 of User root. Feb 20 19:21:20 np0005625471.novalocal sshd-session[92441]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:21:20 np0005625471.novalocal sshd-session[92444]: Received disconnect from 38.102.83.198 port 55306:11: disconnected by user Feb 20 19:21:20 np0005625471.novalocal sshd-session[92444]: Disconnected from user root 38.102.83.198 port 55306 Feb 20 19:21:20 np0005625471.novalocal sshd-session[92441]: pam_unix(sshd:session): session closed for user root Feb 20 19:21:20 np0005625471.novalocal systemd-logind[833]: Session 240 logged out. Waiting for processes to exit. Feb 20 19:21:20 np0005625471.novalocal systemd[1]: session-240.scope: Deactivated successfully. Feb 20 19:21:20 np0005625471.novalocal systemd-logind[833]: Removed session 240. Feb 20 19:21:20 np0005625471.novalocal systemd[1]: session-235.scope: Deactivated successfully. Feb 20 19:21:20 np0005625471.novalocal systemd[1]: session-235.scope: Consumed 12.059s CPU time. Feb 20 19:21:20 np0005625471.novalocal systemd-logind[833]: Removed session 235. Feb 20 19:21:22 np0005625471.novalocal object-server[84159]: Starting object replication pass. Feb 20 19:21:22 np0005625471.novalocal object-server[84159]: 1/1 (100.00%) partitions replicated in 0.00s (374.83/sec, 0s remaining) Feb 20 19:21:22 np0005625471.novalocal object-server[84159]: 0 successes, 0 failures Feb 20 19:21:22 np0005625471.novalocal object-server[84159]: 1 suffixes checked - 0.00% hashed, 0.00% synced Feb 20 19:21:22 np0005625471.novalocal object-server[84159]: Partition times: max 0.0017s, min 0.0017s, med 0.0017s Feb 20 19:21:22 np0005625471.novalocal object-server[84159]: Object replication complete. (0.00 minutes) Feb 20 19:21:23 np0005625471.novalocal sshd-session[92476]: Accepted publickey for root from 38.102.83.198 port 55320 ssh2: ED25519 SHA256:hIUrND1Bf2hx3OQScGUAtluoot9pDyMRJUO1BwpWqvQ Feb 20 19:21:23 np0005625471.novalocal systemd-logind[833]: New session 241 of user root. Feb 20 19:21:23 np0005625471.novalocal systemd[1]: Started Session 241 of User root. Feb 20 19:21:23 np0005625471.novalocal sshd-session[92476]: pam_unix(sshd:session): session opened for user root(uid=0) by root(uid=0) Feb 20 19:21:23 np0005625471.novalocal sshd-session[92479]: Received disconnect from 38.102.83.198 port 55320:11: disconnected by user Feb 20 19:21:23 np0005625471.novalocal sshd-session[92479]: Disconnected from user root 38.102.83.198 port 55320 Feb 20 19:21:23 np0005625471.novalocal sshd-session[92476]: pam_unix(sshd:session): session closed for user root Feb 20 19:21:23 np0005625471.novalocal systemd[1]: session-241.scope: Deactivated successfully. Feb 20 19:21:23 np0005625471.novalocal systemd-logind[833]: Session 241 logged out. Waiting for processes to exit. Feb 20 19:21:23 np0005625471.novalocal systemd-logind[833]: Removed session 241. Feb 20 19:21:24 np0005625471.novalocal object-server[92515]: Begin object audit "forever" mode (ZBF) Feb 20 19:21:24 np0005625471.novalocal object-server[92515]: Object audit (ZBF). Since Sat Feb 21 00:21:24 2026: Locally: 1 passed, 0 quarantined, 0 errors, files/sec: 841.38, bytes/sec: 0.00, Total time: 0.00, Auditing time: 0.00, Rate: 0.00 Feb 20 19:21:24 np0005625471.novalocal object-server[92515]: Object audit (ZBF) "forever" mode completed: 0.00s. Total quarantined: 0, Total errors: 0, Total files/sec: 442.90, Total bytes/sec: 0.00, Auditing time: 0.00, Rate: 0.22 Feb 20 19:21:24 np0005625471.novalocal object-server[92516]: Begin object audit "forever" mode (ALL) Feb 20 19:21:26 np0005625471.novalocal object-server[92516]: Object audit (ALL). Since Sat Feb 21 00:21:24 2026: Locally: 1 passed, 0 quarantined, 0 errors, files/sec: 0.46, bytes/sec: 10015627.82, Total time: 2.17, Auditing time: 0.00, Rate: 0.00 Feb 20 19:21:26 np0005625471.novalocal object-server[92516]: Object audit (ALL) "forever" mode completed: 2.17s. Total quarantined: 0, Total errors: 0, Total files/sec: 0.46, Total bytes/sec: 9998773.26, Auditing time: 2.16, Rate: 1.00 Feb 20 19:21:31 np0005625471.novalocal container-server[83768]: Beginning replication run Feb 20 19:21:31 np0005625471.novalocal container-server[83768]: Replication run OVER Feb 20 19:21:31 np0005625471.novalocal container-server[83768]: Attempted to replicate 1 dbs in 0.01237 seconds (80.86119/s) Feb 20 19:21:31 np0005625471.novalocal container-server[83768]: Removed 0 dbs Feb 20 19:21:31 np0005625471.novalocal container-server[83768]: 1 successes, 0 failures Feb 20 19:21:31 np0005625471.novalocal container-server[83768]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:21:33 np0005625471.novalocal account-server[83378]: Beginning replication run Feb 20 19:21:33 np0005625471.novalocal account-server[83378]: Replication run OVER Feb 20 19:21:33 np0005625471.novalocal account-server[83378]: Attempted to replicate 1 dbs in 0.00801 seconds (124.79920/s) Feb 20 19:21:33 np0005625471.novalocal account-server[83378]: Removed 0 dbs Feb 20 19:21:33 np0005625471.novalocal account-server[83378]: 1 successes, 0 failures Feb 20 19:21:33 np0005625471.novalocal account-server[83378]: diff:0 diff_capped:0 empty:0 hashmatch:0 no_change:1 remote_merge:0 rsync:0 ts_repl:0 Feb 20 19:21:34 np0005625471.novalocal sudo[57982]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:34 np0005625471.novalocal sudo[94053]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kipkichugjphhcnkrvedehernyiohhku ; /usr/bin/python3' Feb 20 19:21:34 np0005625471.novalocal sudo[94053]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:34 np0005625471.novalocal python3[94055]: ansible-command Invoked with creates=/var/log/weirdo/cpuinfo.txt _raw_params=cat /proc/cpuinfo >/var/log/weirdo/cpuinfo.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:34 np0005625471.novalocal sudo[94053]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:34 np0005625471.novalocal sudo[94061]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oweiaqhqccqmnmwqglauhejtpadwjmxc ; /usr/bin/python3' Feb 20 19:21:34 np0005625471.novalocal sudo[94061]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:34 np0005625471.novalocal python3[94063]: ansible-command Invoked with creates=/var/log/weirdo/df.txt _raw_params=df -h >/var/log/weirdo/df.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:34 np0005625471.novalocal sudo[94061]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:34 np0005625471.novalocal sudo[94068]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-onlkuqncxhbyaaghrqdvbbxfpwazyzun ; /usr/bin/python3' Feb 20 19:21:34 np0005625471.novalocal sudo[94068]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:34 np0005625471.novalocal python3[94070]: ansible-command Invoked with creates=/var/log/weirdo/dmesg.txt _raw_params=dmesg -T >/var/log/weirdo/dmesg.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:35 np0005625471.novalocal sudo[94068]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:35 np0005625471.novalocal sudo[94075]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-aztflbpxgruzhhnnecjftxplvsipnzgh ; /usr/bin/python3' Feb 20 19:21:35 np0005625471.novalocal sudo[94075]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:35 np0005625471.novalocal python3[94077]: ansible-command Invoked with creates=/var/log/weirdo/fdisk.txt _raw_params=fdisk -l >/var/log/weirdo/fdisk.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:35 np0005625471.novalocal sudo[94075]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:35 np0005625471.novalocal sudo[94082]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jsnofcrmnxophuteyvwgqvhjdarrsxjy ; /usr/bin/python3' Feb 20 19:21:35 np0005625471.novalocal sudo[94082]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:35 np0005625471.novalocal python3[94084]: ansible-command Invoked with creates=/var/log/weirdo/getenforce.txt _raw_params=getenforce >/var/log/weirdo/getenforce.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:35 np0005625471.novalocal sudo[94082]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:35 np0005625471.novalocal sudo[94089]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jtnkygshmydycywvgnrqgffkdkftkyfo ; /usr/bin/python3' Feb 20 19:21:35 np0005625471.novalocal sudo[94089]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:35 np0005625471.novalocal python3[94091]: ansible-command Invoked with creates=/var/log/weirdo/hosts.txt _raw_params=cat /etc/hosts >/var/log/weirdo/hosts.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:35 np0005625471.novalocal sudo[94089]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:35 np0005625471.novalocal sudo[94096]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fvrfzghrdznviivlhqzkvajjphvokqoh ; /usr/bin/python3' Feb 20 19:21:35 np0005625471.novalocal sudo[94096]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:35 np0005625471.novalocal python3[94098]: ansible-command Invoked with creates=/var/log/weirdo/ip.txt _raw_params=ip a >/var/log/weirdo/ip.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:35 np0005625471.novalocal sudo[94096]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:35 np0005625471.novalocal sudo[94103]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-whxedxemvlplrlaatqqvmoyqrhzqvmhm ; /usr/bin/python3' Feb 20 19:21:35 np0005625471.novalocal sudo[94103]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:36 np0005625471.novalocal python3[94105]: ansible-command Invoked with creates=/var/log/weirdo/iptables.txt _raw_params=iptables -vnL >/var/log/weirdo/iptables.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:36 np0005625471.novalocal sudo[94103]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:36 np0005625471.novalocal sudo[94110]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rexllnevixcbiyhjbgeoscxfpntedlhg ; /usr/bin/python3' Feb 20 19:21:36 np0005625471.novalocal sudo[94110]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:36 np0005625471.novalocal python3[94112]: ansible-command Invoked with creates=/var/log/weirdo/iptables_nat.txt _raw_params=iptables -vnL -t nat >/var/log/weirdo/iptables_nat.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:36 np0005625471.novalocal sudo[94110]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:36 np0005625471.novalocal sudo[94117]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-eecrwfkkylggpnnzveadmbzkjqqnyirk ; /usr/bin/python3' Feb 20 19:21:36 np0005625471.novalocal sudo[94117]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:36 np0005625471.novalocal python3[94119]: ansible-command Invoked with creates=/var/log/weirdo/iptables_mangle.txt _raw_params=iptables -vnL -t mangle >/var/log/weirdo/iptables_mangle.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None Feb 20 19:21:36 np0005625471.novalocal sudo[94117]: pam_unix(sudo:session): session closed for user root Feb 20 19:21:36 np0005625471.novalocal sudo[94124]: zuul-worker : PWD=/home/zuul-worker/src/review.rdoproject.org/rdo-infra/weirdo/playbooks ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mzekiboesupfrkznglbhihqaiqopuzts ; /usr/bin/python3' Feb 20 19:21:36 np0005625471.novalocal sudo[94124]: pam_unix(sudo:session): session opened for user root(uid=0) by zuul-worker(uid=1000) Feb 20 19:21:36 np0005625471.novalocal python3[94126]: ansible-command Invoked with creates=/var/log/weirdo/journalctl.txt _raw_params=journalctl --no-pager >/var/log/weirdo/journalctl.txt _uses_shell=True warn=True stdin_add_newline=True strip_empty_ends=True argv=None chdir=None executable=None removes=None stdin=None